Release	Modification
12.2(31)ZV0d	This command was introduced on the Cisco IOS 10000 series router.
Cisco IOS XE Release 2.4	This command was integrated into Cisco IOS XE Release 2.4.

Command	Description
aaa description-attribute-77	Specifies connection information, which the router copies to attribute 77.
class-vc	Specifies a VC class, which the router copies to attribute 77.
service-policy	Specifies a service policy to be applied to an interface, subinterface, or PVC. To customize attribute 77 for Ethernet connections, enter the connection information as the name of the service policy attached to the Ethernet subinterface. The router takes the policy name and copies it to attribute 77.
show atm class-links	Displays the inheritance level at which the aaa connect-info command is configured.
show atm pvc	Displays the connect-info string, when configured.

ancp adjacency timer

To set the interval between Access Node Control Protocol (ANCP) hello messages, use the ancp adjacency timer command in global configuration mode. To restore the default interval, use the no form of this command.

ancp adjacency timer interval

no ancp adjacency timer interval

Syntax Description

interval

Length of time between ANCP hello messages to ANCP neighbors. The interval is defined in units of 100 ms. Valid values are from 1 to 255. Default: 100 (10 seconds).

Command Default

The interval is 100 ms (10 seconds).

Command Modes

Global configuration (config)

Command History

Release	Modification
12.2(28)ZV	This command was introduced and implemented on the Cisco 10000 series router.
12.2(31)ZV1	This command was modified for ANCP, replacing L2CP.
Cisco IOS XE Release 2.4	This command was integrated into Cisco IOS XE Release 2.4.

Examples

The following example shows how to set the interval between ANCP hello messages from the BRAS to the ANCP access node neighbor identified as dslam1. This example sets the interval to 200 ms.

ancp neighbor id dslam1
ancp adjacency timer 200

Related Commands

Command	Description
ancp enable	Enables ANCP.
ancp neighbor	Specifies the ANCP access node (DSLAM) neighbor.
ancp atm shaper	Enables ANCP cell tax accounting for ATM U-interface connections.

ancp atm shaper

To enable Access Node Control Protocol (ANCP) cell tax accounting for ATM U-interface connections, use the ancp atm shaper command in global configuration mode. To disable ANCP cell tax accounting, use the no form of this command.

ancp atm shaper percent-factor factor

no ancp atm shaper percent-factor factor

Syntax Description

percent-factor

Keyword that indicates to adjust the selected downstream shaping rate by multiplying it by the specified factor.

factor

The percentage by which the selected downstream shaping rate is multiplied. Valid values are from 1 to 100.

The resulting shaping rate is applied to the terminating interface for subscriber links.

Command Default

ANCP cell tax accounting is disabled.

Command Modes

Global configuration (config)

Command History

Release	Modification
12.2(28)ZV	This command was introduced and implemented on the Cisco 10000 series router.
12.2(31)ZV1	This command was modified for ANCP, replacing L2CP.
Cisco IOS XE Release 2.4	This command was integrated into Cisco IOS XE Release 2.4.

Usage Guidelines

The router checks the ANCP dsl-type to enable adjustment to the downstream shaping rate. The dsl-types 1, 2, and 3 correspond to the asymmetric digital subscriber line (ADSL) standards that are used in ATM.

If ATM is specified in the client-ID, the router looks for dsl-type 1, 2, 3 before the router applies the shaper.

Examples

The following example shows how to enable ANCP cell tax accounting using a shaping factor of 95 percent.

Router (config)# ancp atm shaper percent-factor 95

Related Commands

Command	Description
ancp adjacency timer	Specifies the interval between ANCP hello messages.
ancp enable	Enables ANCP.
ancp neighbor	Specifies the ANCP access node neighbor (DSLAM).

ancp enable

To enable Access Network Control Protocol (ANCP) on an IP-enabled interface, use the ancp enable command in ATM virtual circuit configuration or interface configuration mode. To disable ANCP, use the no form of this command.

ancp enable [ neighbor neighbor-name ]

no ancp enable

Syntax Description

neighbor	(Optional) Associates a session with a digital subscriber line access multiplexer (DSLAM) neighbor.
neighbor-name	(Optional) Name of the DSLAM neighbor.

Command Default

ANCP is disabled.

Command Modes

ATM virtual circuit configuration (config-if-atm-vc) Interface configuration (config-if)

Command History

Release	Modification
12.2(28)ZV	This command was introduced on the Cisco 10000 series router.
12.2(31)ZV1	This command was modified. Layer 2 Control Protocol (L2CP) was replaced with ANCP.
Cisco IOS XE Release 2.4	This command was integrated into Cisco IOS XE Release 2.4.
Cisco IOS XE Release 3.2S	This command was modified. The neighbor keyword and neighbor-name argument were added.

Usage Guidelines

You must configure the ancp enable command on an interface on which IP is configured. Do not configure the ancp enablecommandprior to configuring all the ancp neighbor commands because the access node connecting to the broadband remote access server (BRAS) (where ancp enable is configured) relays ANCP Port UP events related to the interfaces. If the ancp neighbor command is not configured for an interface, the client ID in the ANCP Port UP event is not matched, and the message is discarded.

Examples

The following example shows how to enable ANCP on Gigabit Ethernet interface 1/0/1:

interface GigabitEthernet1/0/1
 ip address 10.0.75.123 255.255.255.0
 ancp enable

Related Commands

Command	Description
ancp adjacency timer	Specifies the interval between ANCP hello messages.
ancp atm shaper	Enables ANCP cell tax accounting for ATM U-interface connections.
ancp neighbor	Specifies the ANCP access node neighbor (DSLAM).

ancp enable test-configuration

To enable Access Network Control Protocol (ANCP) test configuration, use the ancp enable test-configurationcommand in global configuration mode. To disable the test configuration, use the no form of this command.

ancp enable test-configuration

no ancp enable test-configuration

Syntax Description

This command has no arguments or keywords.

Command Default

ANCP test configuration is disabled.

Command Modes

Global configuration (config)

Command History

Release	Modification
Cisco IOS XE Release 2.4	This command was introduced.

Usage Guidelines

Use the ancp test-configuration command when you need to test the digital subscriber line (DSL) line rates and the actual upstream and downstream data rates.

Examples

The following example shows how to enable ANCP test configuration:

Router# configure terminal
Router(config)# ancp enable test-configuration

Related Commands

Command	Description
ancp enable	Enables ANCP on an IP-enabled interface.
ancp neighbor	Specifies the ANCP access node neighbor (DSLAM).

ancp neighbor

To define an Access Node Control Protocol (ANCP) neighbor when configuring port mapping between a digital subscriber line access multiplexer (DSLAM) and broadband remote access server (BRAS), use the ancp neighbor command in ATM PVC range configuration, ATM virtual circuit configuration, global configuration, or subinterface configuration mode. To remove the ANCP neighbor, use the no form of this command.

ancp neighbor name dslam-name [ id dslam-id ] client-id client-id

no ancp neighbor name dslam-name [ id dslam-id ] client-id client-id

Syntax Description

name dslam-name	Name of the DSLAM neighbor.
id dslam-id	(Optional) Identifier for the DSLAM neighbor, such as the IP address of the DSLAM. This keyword and argument are required when using this command in global configuration mode.
client-id client-id	Access loop circuit ID for the customer premises equipment (CPE) client of the DSLAM. This keyword and argument are not supported in global configuration mode. The client-id value must be enclosed in quotation marks ("). See the "Usage Guidelines" section for more information.

Command Default

No ports are mapped.

Command Modes

ATM PVC range configuration (config-if-atm-range-pvc) ATM virtual circuit configuration (config-if-atm-vc) Global configuration (config) Subinterface configuration (config-subif)

Command History

Release	Modification
12.2(28)ZV	This command was introduced on the Cisco 10000 series router.
12.2(31)ZV1	This command was modified for ANCP, replacing L2CP.
Cisco IOS XE Release 2.4	This command was integrated into Cisco IOS XE Release 2.4.

Usage Guidelines

Use the ancp neighborcommand when mapping ports between DSL aggregation modems (for example, DSLAMs) and network edge devices in DSL broadband environments. In global configuration mode, this command enters ANCP mapping configuration mode and allows you to group access-node port clients for the DSLAM neighbor and configure access-node port client-to-BRAS port mappings.

The client-id is the access-loop circuit-id for the CPE client of the DSLAM. The client-id has a defined format consisting of an access-node-identifier and line information. The syntax of the client-id is shown below, depending on whether the line is ATM or Ethernet:

"
access-node-identifier
 atm 
slot
/
module
/
port
.
subinterface
:
vpi
.
vci
" 
"
access-node-identifier
 ethernet 
slot
/
module
/
port
.
subinterface
[
:vlan-id
]"

" access-node-identifier	Uniquely identifies the access node in the access network. The access-node-identifier can be the IP address of the DSLAM. The quotation mark (") is required.
atm	The portion of the CPE client circuit-id that specifies ATM as the line.
slot/module/port.subinterface	The portion of the CPE client circuit-id that uniquely identifies the line on the access node.
: vpi . vci "	Virtual path identifier (VPI) and virtual channel identifier (VCI) that uniquely identifies the line on the access node. The quotation mark (") is required.
ethernet	The portion of the CPE client circuit-id that specifies Ethernet as the line.
: vlan-id "	(Optional) The VLAN number assigned to the terminating VLAN subinterface. The VLAN corresponds to the subscriber line. The quotation mark (") is required

Examples

The following example shows how to specify the ANCP neighbor when mapping ports between a DSLAM and the BRAS. In the example, the ANCP neighbor is named dslam1 with an ID of 10.2.3.4.

interface GigabitEthernet8/0/0
 ip address 10.0.75.123 255.255.255.0
 ancp enable
!
policy-map speed:eth:10600:5000:80/0
 description parent shaper for premium
 class class-default
    shape peak 10600
    service-policy premium
!
interface GigabitEthernet8/0/0.1
 encapsulation dot1q 412
!
interface GigabitEthernet8/0/0.2
 encapsulation dot1q 412
!
interface GigabitEthernet8/0/0.3128
 encapsulation dot1q 3 second-dot1q 128
 pppoe enable group global
 service-policy output speed:eth:10600:5000:80/0
!
ancp neighbor name dslam1 id 10.2.3.4
 dot1q 3 second-dot1q 128 client-id "10.2.3.4 ethernet8/0/0.3128"
 dot1q 412 client-id interface GigabitEthernet8/0/0.2 "10.2.3.4 ethernet8/0/0.2"

Related Commands

Command	Description
ancp adjacency timer	Specifies the interval between ANCP hello messages.
ancp enable	Enables ANCP.
dot1q	Maps CPE clients of a DSLAM to VLAN subinterfaces on a BRAS.

ancp truncate

To reduce the downstream Access Node Control Protocol (ANCP) rate, use the ancp truncate command in global configuration mode. To disable the truncating of ANCP rate, use the no form of this command.

ancp truncate kbps

no ancp truncate

Syntax Description

kbps	The value to which the ANCP rate is modified, derived as a logarithm to the base 2. Values are 1, 2, 4, 8, 16, 32, 64, and 128.

Command Default

The ANCP rate is not truncated.

Command Modes

Global configuration (config)

Command History

Release	Modification
15.2(1)S1	This command was introduced.

Usage Guidelines

By modifying the ANCP rate, you reduce the number of unique rates generated. Because each rate requires a unique policy map, a fewer number of policy maps will be required.

Note

Use this command only under exceptional circumstances, such as when the number of unique rates generated result in exceeding the maximum number of policy maps supported on a router.

Examples

The following example shows how to modify the ANCP rate to 64 kbps (2 to the power 6):

Device> enable
Device# configure terminal
Device(config)# ancp truncate 64

Related Commands

Command	Description
ancp adjacency timer	Specifies the interval between ANCP hello messages.
ancp atm shaper	Enables ANCP cell tax accounting for ATM U-interface connections.
ancp enable	Enables ANCP.
ancp neighbor	Specifies the ANCP access node neighbor (DSLAM).

ancp vdsl ethernet shaper

To enable Access Node Control Protocol (ANCP) cell tax accounting for Ethernet U-interface connections, use the ancp vdsl ethernet shaper command in global configuration mode. To disable ANCP cell tax accounting, use the no form of this command.

ancp vdsl ethernet shaper percent-factor factor

no ancp ethernet shaper percent-factor factor

Syntax Description

percent-factor

Adjusts the selected downstream shaping rate by multiplying it by the specified factor.

factor

Percentage by which the selected downstream shaping rate is multiplied. Valid values are from 1 to 100.

The resulting shaping rate is applied to the terminating interface for subscriber links.

Command Default

ANCP cell tax accounting is disabled.

Command Modes

Global configuration (config)

Command History

Release	Modification
12.2(28)ZV2	This command was introduced and implemented on the Cisco 10000 series router.
Cisco IOS XE Release 2.4	This command was integrated into Cisco IOS XE Release 2.4.

Usage Guidelines

You must define the Access-Loop-Circuit-ID in the dot1q command for the router to adjust the downstream shaping rate. The syntax of the Access-Loop-Circuit-ID is:

Aynchronous Transfer Mode/Digital Subscriber Line

"
Access-Node-Identifier
 
atm
 
slot
/
port
:
vpi
.
vci
"

Ethernet/Digital Subscriber Line

"
Access-Node-Identifier
 ethernet
 
slot
/
port
[:
vlan-id
]"

If the DSL type is 4 or 5, the router applies the ancp vdsl ethernet shaper command. Otherwise, the router does not apply the shaping factor.

Note

The ancp vdsl ethernet shaper command supports only VDSL1 (Very-high-bit-rate Digital Subscriber Line) and VDSL2 implementations.

Examples

The following example shows how to enable ANCP cell tax accounting for Ethernet links using a shaping factor of 95 percent.

ancp neighbor id dslam client-ID "10.2.3.4 ethernet1/0/0.1"
ancp vdsl ethernet shaper percent-factor 95
!
policy-map speed:eth:10600:5000:80/0
description parent shaper for premium
class class-default
	shape 10600
	service-policy premium
!
interface GigabitEthernet8/0/0.3128
encapsulation dot1q 3 second-dot1q 128
pppoe enable group global
service-policy output speed:eth:10600:5000:80/0

Related Commands

Command	Description
ancp adjacency timer	Specifies the interval between ANCP hello messages.
ancp enable	Enables ANCP.
ancp neighbor	Specifies the ANCP access node neighbor (DSLAM).

dot1q

To map CPE clients of a DSLAM to 802.1Q VLAN subinterfaces, or to queue-in-queue (Q-in-Q) hierarchical VLAN subinterfaces on a broadband remote access server (BRAS), use the dot1q command in Access Node Control Protocol (ANCP) mapping configuration mode. To remove the mapping, use the no form of this command.

dot1q outer-vlanid [ second-dot1q inner-vlanid ] [ interface type number ] client-id client-id

no dot1q outer-vlanid [ second-dot1q inner-vlanid ] [ interface type number ] client-id client-id

Syntax Description

outer-vlanid	VLAN number assigned to an 802.1Q VLAN subinterface or the VLAN number of the outer VLAN for a Q-in-Q VLAN subinterface. Valid values are from 1 to 4094.
second-dot1q	(Optional) Specifies the second VLAN of a Q-in-Q VLAN subinterface.
inner-vlanid	(Optional) VLAN number assigned to the inner VLAN for a Q-in-Q VLAN subinterface. Valid values are from 1 to 4094.
interface	(Optional) Specifies the subinterface on which the VLAN is configured. This option is required if you configure the same VLAN on multiple physical interfaces.
type	Interface type. For more information, use the question mark (?) online help function.
number	Interface or subinterface number. For more information about the numbering syntax for your networking device, use the question mark (?) online help function.
client-id	Keyword for the customer premises equipment (CPE) client circuit ID for the CPE client of the DSLAM.
client-id	The access loop circuit ID for the CPE client of the DSLAM. The client-id argument has a defined format consisting of an access node identifier and line information. For more information, see the "Usage Guidelines" section.

Command Default

No VLAN interfaces are mapped to client IDs.

Command Modes

ANCP mapping configuration (config-ancp)

Command History

Release	Modification
12.2(28)ZV	This command was introduced and implemented on the Cisco 10000 series router.
12.2(31)ZV1	This command was modified for ANCP, replacing L2CP.
Cisco IOS XE Release 2.4	This command was integrated into Cisco IOS XE Release 2.4.

Usage Guidelines

The client-id is the access-loop-circuit-id for the CPE client of the DSLAM. The client-id has a defined format consisting of an access-node-identifier and line information. The syntax of the client-id is shown below, depending on whether the line is ATM or Ethernet:

"
access-node-identifier
 atm 
slot
/
module
/
port
.
subinterface
:
vpi
.
vci
" 
"
access-node-identifier
 ethernet 
slot
/
module
/
port
.
subinterface
[
:vlan-id
]"

" access-node-identifier	Uniquely identifies the access node in the access network. The access-node-identifier can be the IP address of the DSLAM. The quotation mark (") is required.
atm	The portion of the CPE client circuit-id that specifies ATM as the line.
slot/module/port.subinterface	The portion of the CPE client circuit-id that uniquely identifies the line on the access node.
: vpi . vci "	Virtual path identifier (VPI) and virtual channel identifier (VCI) that uniquely identifies the line on the access node. The quotation mark (") is required.
ethernet	The portion of the CPE client circuit-id that specifies Ethernet as the line.
: vlan-id "	(Optional) The VLAN number assigned to the terminating VLAN subinterface. The VLAN corresponds to the subscriber line. The quotation mark (") is required

Map VLAN interfaces to client-ids by configuring the mapping per DSLAM. When you group the mappings for each DSLAM, the router attempts to determine its corresponding subinterface.

The same VLAN and Q-in-Q can exist under different physical interfaces (for example, interfaces 1/0/0 and 1/0/1), but the same VLAN and Q-in-Q cannot exist under the same physical interface (for example, interface 1/0/0).

If you configure the same VLAN on multiple physical interfaces, you must specify the interface explicitly using the interface type number option of the dot1q command.

Examples

The following example shows how to map a CPE client of the DSLAM named dslamA to a Q-in-Q VLAN subinterface. In the example, the client identified as "10.16.3.4 ethernet1/0/1.1" is mapped to Q-in-Q VLANs 512 and 514.

ancp atm shaper percent-factor 95
interface GigabitEthernet1/0/1
ip address 10.1.75.123 255.255.255.0
ancp enable
!
interface GigabitEthernet1/0/1.1
encapsulation dot1q 512 second-dot1q 514
!
ancp neighbor name dslamA id "10.16.3.4"
dot1q 512 second-dot1q 514 client-ID "10.16.3.4 ethernet1/0/1.1"

The following example shows how to map a client of the DSLAM named dslam1 to an 802.1Q VLAN. In the example, the client identified as 10.2.3.4 ethernet8/0/0.3128 is mapped to queue-in-queue (Q-in-Q) VLANs 3 and 128. Because VLAN 412 is configured on both Gigabit Ethernet subinterfaces 1/0/0.2 and 1/0/1.2, the mapping of client 10.2.3.4 ethernet8/0/0.2 to VLAN 412 explicitly identifies the interface (for example, interface GigabitEthernet 8/0/0.2).

ancp atm shaper percent-factor 95
!
interface GigabitEthernet8/0/0
ip address 10.0.75.123 255.255.255.0
ancp enable
!
policy-map speed:eth:10600:5000:80/0
description parent shaper for premium
	class class-default
	shape 10600
	service-policy premium
!
interface GigabitEthernet8/0/0.1
encapsulation dot1q 412
!
interface GigabitEthernet8/0/0.2
encapsulation dot1q 412
!
interface GigabitEthernet8/0/0.3128
encapsulation dot1q 3 second-dot1q 128
pppoe enable group global
service-policy output speed:eth:10600:5000:80/0
!
ancp neighbor name dslam1 id "10.2.3.4"
dot1q 3 second-dot1q 128 client-ID "10.2.3.4 ethernet8/0/0.3128
dot1q 412 client-ID interface GigabitEthernet8/0/0.2 "10.2.3.4 ethernet8/0/0.2"
radius-server host 192.168.164.228 auth-port 1645 acct-port 1646 non-standard
radius-server vsa send accounting
radius-server vsa send authentication

Related Commands

Command	Description
ancp adjacency timer	Specifies the interval between ANCP hello messages.
ancp atm shaper	Enables ANCP cell tax accounting for ATM U-interface connections.
ancp neighbor	Specifies the ANCP access node neighbor.

ping ancp

To trigger an on-demand local loop test on a digital subscriber line access multiplexer (DSLAM) port, use the ping ancp command in privileged EXEC mode.

ping ancp { interface type number | name neighbor-name } client-id client-id count messages [ timeout seconds ] [ opaque first-handle second-handle ]

Syntax Description

interface type number	Type and number of the interface to ping.
name neighbor-name	Name of the neighbor device to ping.
client-id client-id	Access loop circuit ID for a particular port on the DSLAM.
count messages	Number of loopback messages that should be generated on the local loop. Range: 1 to 32.
timeout seconds	Amount of time in seconds that the broadband remote access server (BRAS) chooses to time out the ping request. An amount of 0 means the BRAS waits indefinitely for a DSLAM-sent port management response. Range: 0 to 255 seconds.
opaque first-handle second-handle	A pair of numbers that the BRAS can choose to uniquely identify each ping request, in addition to using client-id. Range: 0 to 4294967295.

Command Modes

Privileged EXEC (#)

Command History

Release	Modification
12.2(28)ZV2	This command was introduced and implemented on the Cisco 10000 series router.
Cisco IOS XE Release 2.4	This command was integrated into Cisco IOS XE Release 2.4.

Examples

The following example shows how to trigger one on-demand local loopback message from the neighbor device "cisco" on DSLAM port "abc":

Router(config)# ping ancp name cisco client-ID abc count 1

Related Commands

Command	Description
ping	Diagnoses basic network connectivity.

show aaa user

To display attributes related to an authentication, authorization, and accounting (AAA) session, use the show aaa usercommand in privileged EXEC mode.

show aaa user { all | unique-id }

Syntax Description

all	Displays information about all users of which AAA currently has knowledge.
unique-id	Displays information about this user only.

Command Modes

Privileged EXEC (#)

Command History

Release	Modification
12.2(4)T	This command was introduced.
12.2(31)ZV1	This command was modified to display the user name first and then the accounting data and was implemented on the Cisco 10000 series router for the PRE3.
Cisco IOS XE Release 2.4	This command was integrated into Cisco IOS XE Release 2.4.

Usage Guidelines

When a user logs into a Cisco router and uses AAA, a unique ID is assigned to the session. Throughout the life of the session, various attributes that are related to the session are collected and stored internally within a AAA database. These attributes can include the IP address of the user, the protocol being used to access the router (such as PPP or Serial Line Internet Protocol [SLIP]), the speed of the connection, and the number of packets or bytes that are received or transmitted.

The output of this command:

Provides a snapshot of various subdatabases that are associated with a AAA unique ID. Some of the more important ones are listed in the table below.
Shows various AAA call events that are associated with a particular session. For example, when a session comes up, the events generally recorded are CALL START, NET UP, and IP Control Protocol UP (IPCP UP).
Provides a snapshot of the dynamic attributes that are associated with a particular session. (Dynamic attributes are those that keep changing values throughout the life of the session.) Some of the more important ones are listed in the table below.

The unique ID of a session can be obtained from the output of the show aaa sessions command.

Note

This command does not provide information for all users who are logged into a device, but only for those who have been authenticated or authorized using AAA or only for those whose sessions are being accounted for by the AAA module.

Note

When you use the all keyword, a large amount of output may be produced, depending on the number of users who are logged into the device at any time.

Examples

The following example shows that information is requested for all users:

Router# show aaa user all

The following example shows that information is requested for user 5:

Router# show aaa user 5

The following is sample output from the show aaa user command. The session information displayed is for a PPP over Ethernet over Ethernet (PPPoEoE) session.

Router# show aaa user 3
Load for five secs: 0%/0%; one minute: 0%; five minutes: 0%
Time source is hardware calendar, *20:32:49.199 PST Wed Dec 17 
2003
  Unique id 3 is currently in use.
  Accounting:
    log=0x20C201
    Events recorded :
      CALL START
      NET UP
      IPCP_PASS
      INTERIM START
      VPDN NET UP
  update method(s) :
    NONE
  update interval = 0
  Outstanding Stop Records : 0
  Dynamic attribute list:
    63CCF138 0 00000001 connect-progress(30) 4 LAN Ses Up
    63CCF14C 0 00000001 pre-session-time(239) 4 3(3)
    63CCF160 0 00000001 nas-tx-speed(337) 4 102400000(61A8000)
    63CCF174 0 00000001 nas-rx-speed(33) 4 102400000(61A8000)
    63CCF188 0 00000001 elapsed_time(296) 4 2205(89D)
    63CCF19C 0 00000001 bytes_in(97) 4 6072(17B8)
    63CCF1B0 0 00000001 bytes_out(223) 4 6072(17B8)
    63CCF1C4 0 00000001 pre-bytes-in(235) 4 86(56)
    63CCF1D8 0 00000001 pre-bytes-out(236) 4 90(5A)
    63CCF1EC 0 00000001 paks_in(98) 4 434(1B2)
    63CCF244 0 00000001 paks_out(224) 4 434(1B2)
    63CCF258 0 00000001 pre-paks-in(237) 4 7(7)
    63CCF26C 0 00000001 pre-paks-out(238) 4 9(9)
  No data for type EXEC
  No data for type CONN
  NET: Username=peer1
    Session Id=00000003 Unique Id=00000003
    Start Sent=1 Stop Only=N
    stop_has_been_sent=N
    Method List=63B4A10C : Name = default
    Attribute list:
    63CCF138 0 00000001 session-id(293) 4 3(3)
    63CCF14C 0 00000001 Framed-Protocol(62) 4 PPP
    63CCF160 0 00000001 protocol(241) 4 ip
    63CCF174 0 00000001 addr(5) 4 70.0.0.1
  No data for type CMD
  No data for type SYSTEM
  No data for type RM CALL
  No data for type RM VPDN
  No data for type AUTH PROXY
  No data for type IPSEC-TUNNEL
  No data for type RESOURCE
  No data for type 10
  No data for type CALL
Debg: No data available
Radi: 641AACAC
Interface:
  TTY Num = -1
  Stop Received = 0
  Byte/Packet Counts till Call Start:
    Start Bytes In = 106      Start Bytes Out = 168      
    Start Paks    In = 3      Start Paks  Out = 4          
  Byte/Packet Counts till Service Up:
    Pre Bytes In = 192      Pre Bytes Out = 258      
    Pre Paks  In = 10      Pre Paks  Out = 13      
  Cumulative Byte/Packet Counts :
    Bytes In = 6264      Bytes Out = 6330      
    Paks  In = 444      Paks  Out = 447      
  StartTime = 19:56:01 PST Dec 17 2003
  AuthenTime = 19:56:04 PST Dec 17 2003
  Component = PPoE
Authen: service=PPP type=CHAP method=RADIUS
Kerb: No data available
Meth: No data available
Preauth: No Preauth data.
General:
  Unique Id = 00000003
  Session Id = 00000003
  Attribute List:
    63CCF180 0 00000001 port-type(156) 4 PPP over Ethernet
    63CCF194 0 00000009 interface(152) 7 0/0/0/0
PerU: No data available

The table below lists the significant fields shown in the display.

Table 1

show aaa user Field Descriptions

Field	Description
EXEC	Exec-Accounting database.
NET	Network Accounting database.
CMD	Command Accounting database.
Pre Bytes In	Bytes that were received before the call was authenticated.
Pre Bytes Out	Bytes that were transmitted before the call was authenticated.
Pre Paks In	Packets that were received before the call was authenticated.
Pre Paks Out	Packets that were transmitted before the call was authenticated.
Bytes In	Bytes that were received after the call was authenticated.
Bytes Out	Bytes that were transmitted after the call was authenticated.
Paks In	Packets that were received after the call was authenticated.
Paks Out	Packets that were transmitted after the call was authenticated.
Authen	Authentication database.
General	General database.
PerU	Per-User database.

Related Commands

Command	Description
show aaa sessions	Displays information about AAA sessions as seen in the AAA Session MIB.

show ancp an-port

To display information about Access Node Control Protocol (ANCP) Access Node (AN) ports, use the showancpan-portcommand in user EXEC or privileged EXEC mode.

show ancp an-port { dynamic-only [ statistics] | interface type number | summary [ statistics] }

Syntax Description

dynamic-only	Displays the summary of AN ports that are not mapped to any local subinterfaces.
statistics	(Optional) Displays the summary of message statistics for AN ports that are not mapped to any local subinterfaces.
interface	Displays information about an AN port and the corresponding subscriber access line identified by a local interface mapped to the port.
type	Interface type. For more information, use the question mark (?) online help function.
number	Interface or subinterface number. For more information about the numbering syntax for your networking device, use the question mark (?) online help function.
summary	Displays a summary of all AN ports.
statistics	(Optional) Displays the aggregate ANCP event message statistics.

Command Modes

User EXEC (>) Privileged EXEC (#)

Command History

Release	Modification
Cisco IOS XE Release 3.2S	This command was introduced.

Examples

The following is sample output from the showancpan-portdynamic-onlystatistics command:

Router# show ancp an-port dynamic-only statistics
  List of AN port statistics for ports not mapped to local sub-interfaces
  Circuit-id                     Port Up    Port Down
  ------------------------------ ---------- ---------
  alcid1                            2          0

The table below describes the fields shown in the display.

Table 2

show ancp an-port dynamic-only statistics Field Descriptions

Field	Description
Circuit-id	Circuit-ID is the Access-Loop Circuit ID of the ANCP protocol. For more information on Access-Loop-Circuit-ID Type-Length-Value (TLV), see http://datatracker.ietf.org/doc/draft-ietf-ancp-protocol/.
Port Up	Number of port-up event messages received.
Port Down	Number of port-down event messages received.

The following is sample output from the showancpan-portinterface command:

Router# show ancp an-port interface ethernet0/0.2
 AN port Circuit-ID "alcid1":
 State                                     UP
 Uptime                                    00:34:25
 Time Since Last Message                   00:34:25
 Encap Type                                qinq
 DSL type                                  VDSL1
 DSL Line State                            SHOWTIME
 Neighbor sender-name                      aabb.cc00.7c00
 Neighbor description                      neighbor1
 Configured Rate Adjustment                100%
 Actual Downstream Data Rate (kbps)        9090
 Effective Downstream Data Rate (kbps)     9090

The table below describes the significant fields shown in the display.

Table 3

show ancp an-port interface Field Descriptions

Field	Description
State	State of the AN port (up or down).
Uptime	Time since an AN port is up.
Time Since Last Message	Time since the last message was received.
Encap Type	Type of encapsulation.
DSL type	Type of Digital Subscriber Line (DSL).
DSL Line State	State of the DSL line. The state field will appear with one of the following values: UNKNOWN--Unknown state. SHOWTIME--Active state. IDLE--Idle state. SILENT--Silent state.
Neighbor sender-name	Sender of the ANCP session identifier.
Neighbor description	ANCP session identifier.
Configured Rate Adjustment	Value configured through an ANCP ATM shaper percent-factor for ATM or through an ANCP very-high-bit-rate digital subscriber line (VDSL) Ethernet shaper percent-factor for Ethernet for VDSL.
Actual Downstream Data Rate (kbps)	Actual downstream net data rate on a DSL line.
Effective Downstream Data Rate (kbps)	Value after applying the downstream data rate adjustment.

The following is sample output from the showancpan-portsummary command:

Router# show ancp an-port summary
 AN Port Summary
 ---------------------------------
 State UP                5
 State DOWN              1
 Total                   6

The table below describes the fields shown in the display.

Table 4

show ancp an-port summary Field Descriptions

Field	Description
AN Port Summary	Summary of all AN ports.
State UP	Number of ports that are enabled .
State DOWN	Number of ports that are disabled.
Total	Total number of AN ports.

The following is sample output from the showancpan-portsummarystatistics command:

Router# show ancp an-port summary statistics
    AN Port Message Statistics Summary
    ----------------------------------
    Port UP            27
    Port DOWN          3

The table below describes the fields shown in the display.

Table 5

show ancp an-port summary statistics Field Descriptions

Field	Description
Port UP	Number of port-up event messages received.
Port DOWN	Number of port-down event messages received.

Related Commands

Command	Description
ancp enable	Enables ANCP on an IP-enabled interface.

show ancp an-port circuit-id

To display information about an Access Node Control Protocol (ANCP) Access Node (AN) port and the corresponding subscriber access line identified by the subscriber circuit ID, use the showancpan-portcircuit-id command in user EXEC or privileged EXEC mode.

show ancp an-port circuit-id name [ detail | statistics ]

Syntax Description

name	Subscriber circuit ID.
detail	(Optional) Displays details of an AN port and the corresponding subscriber access line identified by the subscriber circuit ID. This display also includes a list of local interfaces mapped to the port through an ANCP configuration.
statistics	(Optional) Displays message statistics for an AN port identified by the subscriber circuit ID.

Command Modes

User EXEC (>) Privileged EXEC (#)

Command History

Release	Modification
Cisco IOS XE Release 3.2S	This command was introduced.

Examples

The following is sample output from the showancpan-portcircuit-iddetail command:

Router# show ancp an-port circuit-id g_alcid1 detail
 AN port Circuit-ID "g_alcid1":
 State                                                       UP
 Uptime                                                      00:33:23
 Time Since Last Message                                     00:33:23
 Encap Type                                                  dot1q
 DSL type                                                    VDSL1
 DSL Line State                                              SHOWTIME
 Neighbor sender-name                                        aabb.cc00.7c00
 Neighbor description                                        glob
 Configured Rate Adjustment                                  100%
 Actual Downstream Data Rate (kbps)                          9090
 Effective Downstream Data Rate (kbps)                       9090
Actual Data Rate Upstream/Downstream (kbps)                  7878/9090
 Default Data Rate Upstream/Downstream (bps)                 0/0
 Minimum Data Rate Upstream/Downstream (kbps)                0/0
 Attainable Data Rate Upstream/Downstream (kbps)             0/0
 Maximum Data Rate Upstream/Downstream (kbps)                0/0
 Minimum Low Power Data Rate Upstream/Downstream (kbps)      0/0
 Maximum Interleaving Delay Upstream/Downstream (ms)         0/0
 Actual Interleaving Delay Upstream/Downstream (ms)          0/0
.
.
.

The table below describes the significant fields shown in the display.

Table 6

show ancp an-port circuit-id detail Field Descriptions

Field	Description
State	State of the AN port (up or down).
Uptime	Time since the AN port is up.
Time Since Last Message	Time after the last message was received.
Encap Type	Type of encapsulation.
DSL type	Type of Digital Subscriber Line (DSL).
DSL Line State	State of the DSL line. The state field will appear with one of the following values: UNKNOWN--Unknown state. SHOWTIME--Active state. IDLE--Idle state. SILENT--Silent state.
Neighbor sender-name	Sender of the ANCP session identifier.
Neighbor description	ANCP session identifier.
Configured Rate Adjustment	Value configured through an ANCP ATM shaper percent-factor in case of ATM or through an ANCP very-high-bit-rate digital subscriber line (VDSL) Ethernet shaper percent-factor in case of Ethernet for VDSL.
Actual Downstream Data Rate (kbps)	Actual downstream net data rate on a DSL line.
Effective Downstream Data Rate (kbps)	Value after applying the downstream data rate adjustment.

Related Commands

Command	Description
show ancp an-port	Displays information about ANCP AN ports.

show ancp an-port neighbor description

To display information about the Access Node (AN) ports associated with an Access Node Control Protocol (ANCP) neighbor identified by a description name, use the showancpan-portneighbordescriptioncommand in user EXEC or privileged EXEC mode.

show ancp an-port neighbor description name [ statistics]

Syntax Description

name	Name of the ANCP neighbor.
statistics	(Optional) Displays the summary of message statistics for AN ports associated with an ANCP neighbor identified by the description name.

Command Modes

User EXEC (>) Privileged EXEC (#)

Command History

Release	Modification
Cisco IOS XE Release 3.2S	This command was introduced.

Usage Guidelines

The output of the showancpan-portneighbordescriptioncommand displays a list of ports associated with a specified neighbor and the state of these ports.

Examples

The following is sample output from the showancpan-portneighbordescription command:

Router# show ancp an-port neighbor description dslam
 ----------------------------------- -------- --------------------
 Circuit-ID    State      Uptime   Line State    Adjusted DS Rate (kbps)
 ------------------------------ ------------- -------- ------------
 alcid2         DOWN                UNKNOWN                  0

The following is sample output from the showancpan-portneighbordescriptionstatistics command:

Router# show ancp an-port neighbor description glob statistics
 
 List of AN port statistics for neighbor description glob
 ------------------------------ --------- ---------
 Circuit-ID                     Port Up   Port Down
 ------------------------------ --------- ---------
 g_alcid1                       2         1        
 g_alcid2                       2         1        
 g_alcid3                       1         0        
 g_alcid4                       1         0

The table below describes the fields shown in the displays.

Table 7

show ancp an-port neighbor description Field Descriptions

Field	Description
Circuit-ID	Access-Loop Circuit ID of the ANCP protocol. For more information on Access-Loop-Circuit-ID Type-Length-Value (TLV), see http://datatracker.ietf.org/doc/draft-ietf-ancp-protocol/ .
State	State of the AN port (up or down).
Uptime	Time since the AN port is up.
Line State	State of the Digital Subscriber Line (DSL) line. The state field will appear with one of the following values: UNKNOWN--Unknown state. SHOWTIME--Active state. IDLE--Idle state. SILENT--Silent state.
Adjusted DS Rate (kbps)	Actual upstream net data rate on a DSL line.
Port Up	Number of ports that are up.
Port Down	Number of ports that are down.

Related Commands

Command	Description
ancp neighbor	Defines an ANCP neighbor when configuring port mapping between a DSLAM and a BRAS.
show ancp an-port	Displays information about ANCP AN ports.

show ancp neighbor

To display statistics of Access Node Control Protocol (ANCP) neighbor information and neighborship information with local ANCP ports, use the showancpneighborcommand in user EXEC mode or privileged EXEC mode.

Syntax Description

brief	(Optional) Displays summary information about all ANCP neighbors.
detail	(Optional) Displays detailed information about all ANCP neighbors.
id neighbor-id	(Optional) Identifies an ANCP session.
name neighbor-name	(Optional) Identifies an ANCP session.
port	(Optional) Displays ANCP neighbor port information.
statistics	(Optional) Displays a summary of ANCP neighbor port statistics.
client-id access-loop-circuit-id	(Optional) Displays information related to the specified port.
statistics	(Optional) Displays message statistics for all active or configured ANCP neighbors.
summary	(Optional) Displays a summary of the ANCP neighbors identified by an ANCP session state.
statistics	(Optional) Displays the aggregate ANCP session message statistics.

Command Default

ANCP neighbor information statistics are displayed.

Command Modes

User EXEC (>) Privileged EXEC (#)

Command History

Release	Modification
12.2(28)ZV2	This command was introduced and implemented on the Cisco 10000 series router.
Cisco IOS XE Release 2.4	This command was integrated into Cisco IOS XE Release 2.4.
Cisco IOS XE Release 3.2S	This command was modified. The statistics and summary keywords were added.

Usage Guidelines

The access loop circuit ID is a unique ID that the digital subscriber line access multiplexer (DSLAM) sends to the broadband remote access server (BRAS) for each unique port.

Examples

The following is sample output from the showancpneighborportstatistics command. The output fields are self-explanatory.

Router# show ancp neighbor port statistics
Remote Peer Line Statistics
===========================
3     DSL lines in UNKNOWN state
1     DSL lines in SHOWTIME state
0     DSL lines in IDLE state
0     DSL lines in SILENT state
4     Total DSL Lines

The following is sample output from the showancpneighborportcommand:

Router# show ancp neighbor port
Neighbor  Access Loop Circuit ID  Up/Downstream DSL Line  ANCP Port
Name/ID                           (kbps)        State     State
--------- ----------------------- ------------- --------- ---------
VendorB_10.3.1.2/10.3.1.2
          10.3.1.2 eth 1/162 3:11 0/0           IDLE      DOWN
VendorC_10.3.1.2/10.3.1.2
          10.3.1.2 eth 1/162 3:21 0/0           SILENT    DOWN
VendorA_10.3.1.2/10.3.1.2
          10.3.1.2 eth 1/162 3:10 45078/89560   SHOWTIME  UP
          10.3.1.2 eth 1/161 3:9  0/0           UNKNOWN   DOWN

The table below describes the significant fields shown in the display.

Table 8

show ancp neighbor port Field Descriptions

Field	Description
Neighbor Name/ID	ANCP session identifier.
Access Loop Circuit ID	Unique ID that the DSLAM sends to the BRAS for each unique port.
DSL Line State	State of the DSL line. The state field will appear with one of the following values: UNKNOWN--Unknown state. SHOWTIME--Active state. IDLE--Idle state. SILENT--Silent state.
ANCP Port State	State of the ANCP port.

The following is sample output from the showancpneighborportdetailcommand:

Router# show ancp neighbor detail
 DSLAM   BRAS  vlan tag  interface    client-ID name/ID port

--------------------------------------------------------

': global, +: global&interface, -: interface, x: global&inactive 'dslam/d1
qinq  2/4 Et0/0.2      alcid1
          ANCP Port State                                        UP
          DSL type/DSL Line State                        ADSL1/SHOWTIME
          Actual Data Rate Upstream/Downstream (kbps)        7800/8900
          Default Data Rate Upstream/Downstream (bps)            0/0
          Minimum Data Rate Upstream/Downstream (kbps)           0/0
          Attainable Data Rate Upstream/Downstream (kbps)        0/0
          Maximum Data Rate Upstream/Downstream (kbps)           0/0
          Minimum Low Power Data Rate Upstream/Downstream (kbps) 0/0
          Maximum Interleaving Delay Upstream/Downstream (ms)    0/0
          Actual Interleaving Delay Upstream/Downstream (ms)     0/0
qinq  2/6 Et0/0.3      alcid2
          ANCP Port State                                            UP
          DSL type/DSL Line State                            VDSL1/SHOWTIME
          Actual Data Rate Upstream/Downstream (kbps)            7869/9080
          Default Data Rate Upstream/Downstream (bps)            0/0
          Minimum Data Rate Upstream/Downstream (kbps)           3445/4645
          Attainable Data Rate Upstream/Downstream (kbps)        43546/6768
          Maximum Data Rate Upstream/Downstream (kbps)           8080/9090
          Minimum Low Power Data Rate Upstream/Downstream (kbps) 1213/5634
          Maximum Interleaving Delay Upstream/Downstream (ms)    7878/8989
          Actual Interleaving Delay Upstream/Downstream (ms)     6787/7898

The following is sample output from the showancpneighborstatistics command:

Router# show ancp neighbor statistics
 Displaying all neighbor statistics
 ----------------------------------
 Neighbor sender-name 7200-client, description 0006.2aaa.281b
                  Sent          Received
    SYN           1             3
    SYNACK        1             0
    ACK           163           165
    RSTACK        0             0
    Port Up       -             14
    Port Down     -             1
    Drops         0             0
    Total         165           183

The table below describes the significant fields shown in the display.

Table 9

show ancp neighbor statistics Field Descriptions

Field	Description
SYN	Number of synchronization state messages received and sent.
SYNACK	Number of acknowledgment messages received and sent for the synchronization state messages that were received and sent.
Port Up	Number of ports that are enabled.
Port Down	Number of ports that are disabled.
Drops	Number of dropped messages.
Total	Total number of ANCP ports.

The following is sample output from the showancpneighborsummary command. The output fields are self-explanatory.

Router# show ancp neighbor summary
    ANCP Neighbor Summary Information
    ---------------------------------
    Neighbor count by state:
      -               0
      SYNSENT         0
      SYNRCVD         0
      ESTAB           1
      ---------------------
      Total           1

The following is sample output from the showancpneighborsummarystatistics command. The output fields are self-explanatory.

Router# show ancp neighbor summary statistics
     ANCP Summary Neighbor Statistics
  -------------------------------------
                  Sent          Received
    SYN           5             12
    SYNACK        2             0
    ACK           299           303
    RSTACK        0             0
    Port Up       -             27
    Port Down     -             3
    Drops         0             0
    Total         306           345

Related Commands

Command	Description
show ancp port	Displays statistics of all ANCP local ports and their respective status and neighbor information.
show ancp session	Displays details of ANCP sessions and statistics of sessions in each state.
show ancp session event	Displays a snapshot of the last ANCP session event on each port of all neighbors.
show ancp statistics	Collects summaries and statistics from show commands and displays the statistics at one location.
show ancp status	Displays ANCP status information for ANCP endpoints configured on a BRAS interface.

show ancp neighbor description

To display brief information about an Access Node Control Protocol (ANCP) neighbor that is identified by a description name, use the showancpneighbordescriptioncommand in user EXEC or privileged EXEC mode.

show ancp neighbor description name [ detail | statistics ]

Syntax Description

name	Description name of the neighbor.
detail	(Optional) Displays the details of an ANCP neighbor that is identified by the description name. The displayed information includes a summary of the Access Node (AN) ports that are associated with the neighbor.
statistics	(Optional) Displays message statistics for an ANCP neighbor that is identified by the ANCP sender name.

Command Modes

User EXEC (>) Privileged EXEC (#)

Command History

Release	Modification
Cisco IOS XE Release 3.2S	This command was introduced.

Examples

The following is sample output from the showancpneighbordescriptiondetailcommand:

Router# show ancp neighbor description glob detail
             ANCP Neighbor Data
 ----------------------------------------------------------
 Sender Name              aabb.cc00.7c00
 Description              glob
 State                    ESTAB
 Capability               Topology Discovery, OAM
 Ports:
   State Up        4
   State Down      0
   Total           4
 Remote IP Addr/TCP Port    192.0.2.1/50828
 Local IP Addr/TCP Port     192.0.2.254/6068
 Server Sender Name         aabb.cc00.7a00
 Remote Timeout             30000 ms
 Local Timeout              30000 ms
 Adjacency Uptime           02:54:47
 Time Since Last Port Msg   00:31:03
 Remote Instance            1
 Local Instance             1
 Remote Partition ID        0
 List of-AN port data for neighbor sender name aabb.cc00.7c00
 ----------------------------------- -------- --------------------
                                    Line        Adjusted DS
 Circuit-ID    State    Uptime      State       Rate (kbps)
 ----------------------------------- -------- --------------------
 g_alcid1      UP       00:31:10    SHOWTIME    9090
 g_alcid2      UP       00:31:08    SHOWTIME    9090
 g_alcid3      UP       00:31:04    SHOWTIME    9090
 g_alcid4      UP       00:31:03    SHOWTIME    9090

The table below describes the significant fields shown in the display.

Table 10

show ancp neighbor description detail Field Descriptions

Field	Description
Sender Name	Remote sender name or MAC address of the peer that is exchanged through ANCP adjacency messages.
Description	Description name of the neighbor.
State	ANCP adjacency state. It can be any one of the following: ESTAB--Session established. DOWN--Session down. SYNRCVD--Synchronization state messages received. SYNSENT--Synchronization state message sent.
Capability	Set of capabilities negotiated for this session in the adjacency establishment phase. It can be either topology discovery capabilities or operations, administration, and maintenance (OAM) capabilities.
State Up	Number of ports under the neighbor that are in the up state.
State Down	Number of ports under the neighbor that are in the down state.
Total	Total number of ports under the neighbor.
Remote IP Addr/TCP Port	Remote IP address and port for the TCP session.
Local IP Addr/TCP Port	Local IP address and port for the TCP session.
Server Sender Name	MAC address of the server.
Remote Timeout	Remote timeout calculated based on the adjacency interval.
Local Timeout	Local timeout calculated based on the adjacency interval.
Adjacency Uptime	Time since an AN port is up.
Circuit-ID	Access-Loop Circuit ID of the ANCP protocol. For more information on Access-Loop-Circuit-ID Type-Length-Value (TLV), see http://datatracker.ietf.org/doc/draft-ietf-ancp-protocol/.
Line State	State of the DSL line. The state field will appear with one of the following values: UNKNOWN--Unknown state. SHOWTIME--Active state. IDLE--Idle state. SILENT--Silent state.
Adjusted DS Rate (kbps)	Actual downstream net data rate on a DSL line.

Related Commands

Command	Description
ancp neighbor	Defines an ANCP neighbor when configuring port mapping between a DSLAM and a BRAS.
show ancp neighbor	Displays statistics of ANCP neighbor information and neighborship information with local ANCP ports.

show ancp neighbor sender-name

To display brief information about an Access Node Control Protocol (ANCP) session that has a neighbor identified by an ANCP sender name, use the showancpneighborsender-name command in user EXEC or privileged EXEC mode.

show ancp neighbor sender-name address

Syntax Description

address

Sender address. This argument can be either a MAC address or an IPv4 address.

Command Modes

User EXEC (>) Privileged EXEC (#)

Command History

Release	Modification
Cisco IOS XE Release 3.2S	This command was introduced.

Examples

The following is sample output from the showancpneighborsender-name command:

Router# show ancp neighbor sender-name aabb.cc00.7c00
              ANCP Neighbor Data
  ----------------------------------------------
  Sender Name                 aabb.cc00.7c00
  Description                 neigbhor1
  State                       ESTAB
  Capability                  Topology Discovery, OAM
  Ports:
    State Up                  4
    State Down                0
    Total                     4

The table below describes the significant fields shown in the display.

Table 11

show ancp neighbor sender-name Field Descriptions

Field	Description
Sender Name	Sender of the ANCP session identifier.
Description	ANCP session identifier.
State	ANCP adjacency state. It can be any one of the following: ESTAB--Session established. DOWN--Session down. SYNRCVD--Synchronization state messages received. SYNSENT--Synchronization state message sent.
Capability	Set of capabilities negotiated for this session in the adjacency establishment phase. It can be either topology discovery capabilities or operations, administration, and maintenance (OAM) capabilities.
State Up	Number of ports that are enabled .
State Down	Number of ports that are disabled.
Total	Total number of AN ports.

Related Commands

Command	Description
ancp neighbor	Defines an ANCP neighbor when configuring port mapping between a DSLAM and a BRAS.
show ancp neighbor	Displays statistics of ANCP neighbor information and neighborship information with local ANCP ports.

show ancp neighbor statistics

To display message statistics of all active or configured Access Node Control Protocol (ANCP) neighbors, use the showancpneighborstatistics command in user EXEC or privileged EXEC mode.

show ancp neighbor statistics

Syntax Description

This command has no arguments or keywords.

Command Modes

User EXEC (>) Privileged EXEC (#)

Command History

Release	Modification
Cisco IOS XE Release 3.2S	This command was introduced.

Examples

The following is sample output from the showancpneighborstatistics command:

Router# show ancp neighbor statistics
    Displaying all neighbor statistics
 ----------------------------------
     Sender-name aabb.cc00.7c00
     Description dslam
   -----------------------------------
                  Sent          Received
    SYN           1             1
    SYNACK        1             1
    ACK           1056          1056
    RSTACK        0             0
    Port UP       -             1
    Port DOWN     -             0
    Port Mgmt     0             0
    Total         1058         1059

The table below describes the significant fields shown in the display.

Table 12

show ancp neighbor statistics Field Descriptions

Field	Description
SYN	Number of synchronization state messages received and sent.
SYNACK	Number of acknowledgment messages received and sent for the synchronization state messages that were received and sent.
Port UP	Number of port-up event messages.
Port DOWN	Number of port-down event messages.
Total	Total number of messages sent and received.

Related Commands

Command	Description
ancp neighbor	Defines an ANCP neighbor when configuring port mapping between a DSLAM and a BRAS.
show ancp neighbor	Displays statistics of ANCP neighbor information and neighborship information with local ANCP ports.

show ancp neighbor summary

To display a summary of the Access Node Control Protocol (ANCP) neighbors, use the showancpneighborsummarycommand in user EXEC or privileged EXEC mode.

show ancp neighbor summary [ statistics]

Syntax Description

statistics

(Optional) Displays the aggregate ANCP session message statistics.

Command Modes

User EXEC (>) Privileged EXEC (#)

Command History

Release	Modification
Cisco IOS XE Release 3.2S	This command was introduced.

Examples

The following is sample output from the showancpneighborsummary command:

Router# show ancp neighbor summary
    ANCP Neighbor Summary Information
    ---------------------------------
    Neighbor count by state:
      DOWN             0
      ESTAB            4
      SYNRCVD          0
      SYNSENT          0
      ----------------------
      Total            4

The table below describes the significant fields shown in the display.

Table 13

show ancp neighbor summary Field Descriptions

Field	Description
DOWN	Number of sessions that are down.
ESTAB	Number of sessions in established state.
Total	Total number of sessions.

The following is sample output from the showancpneighborsummarystatistics command:

Router# show ancp neighbor summary statistics
     ANCP Summary Neighbor Statistics
  -------------------------------------
                  Sent          Received
    SYN           5             12
    SYNACK        2             0
    ACK           299           303
    RSTACK        0             0
    Port Up       -             27
    Port Down     -             3
    Drops         0             0
    Total         306           345

The table below describes the significant fields shown in the display.

Table 14

show ancp neighbor summary statistics Field Descriptions

Field	Description
SYN	Number of synchronization state messages received and sent.
SYNACK	Number of acknowledgment messages received and sent for the synchronization state messages that were received and sent.
Port Up	Number of port-up event messages.
Port Down	Number of port-down event messages.
Total	Total number of messages sent and received.

Related Commands

Command	Description
ancp neighbor	Defines an ANCP neighbor when configuring port mapping between a DSLAM and a BRAS.
show ancp neighbor	Displays statistics of ANCP neighbor information and neighborship information with local ANCP ports.

show ancp port

To display statistics of all Access Node Control Protocol (ANCP) local ports and their respective status and neighbor information, use the showancpport command in user EXEC mode or privileged EXEC mode.

show ancp port [ statistics | client-id access-loop-circuit-id ]

Syntax Description

statistics	(Optional) Displays a summary of all ANCP port statistics.
client-id access-loop-circuit-id	(Optional) Only information related to the specified port appears.

Command Default

Statistics of all ANCP local ports are displayed.

Command Modes

User EXEC (>) Privileged EXEC (#)

Command History

Release	Modification
12.2(28)ZV2	This command was introduced and implemented on the Cisco 10000 series router.
Cisco IOS XE Release 2.4	This command was integrated into Cisco IOS XE Release 2.4.

Usage Guidelines

The access loop circuit ID is a unique ID that the digital subscriber line access multiplexer (DSLAM) sends to the broadband remote access server (BRAS) for each unique port.

Examples

The following example shows sample output that appears when you enter the showancpportstatistics command:

Router# show ancp port statistics
ANCP Port Statistics
====================
1     ANCP ports in UP state
3     ANCP ports in DOWN state
4     Total ANCP ports

The following example shows sample output that appears when you enter the showancpportclient-idaccess-loop-circuit-id command:

Router# show ancp port client-id abc
Neighbor  Access Loop Circuit ID  Up/Downstream ANCP Port DSL Line
Name/ID                           (kbps)        State     State
--------- ----------------------- ------------- --------- ---------
VendorB_10.3.1.2/10.3.1.2
          10.3.1.2 eth 1/162 3:11 0/0           DOWN      UNKNOWN
VendorC_10.3.1.2/10.3.1.2
          10.3.1.2 eth 1/162 3:21 0/0           DOWN      SILENT
VendorA_10.3.1.2/10.3.1.2
          10.3.1.2 eth 1/162 3:10 45078/89560   UP        SHOWTIME

The table below lists the significant fields shown in the display.

Table 15

show ancp port Field Descriptions

Field	Description
Neighbor Name/ID	ANCP session identifier.
Access Loop Circuit ID	Unique ID that the DSLAM sends to the BRAS for each unique port.
ANCP Port State	State of the ANCP port.
DSL Line State	State of the DSL line. The state field will appear with one of the following values: UNKNOWN--Unknown state. SHOWTIME--Active state. IDLE--Idle state. SILENT--Silent state.

Related Commands

Command	Description
show ancp neighbor	Displays statistics of ANCP neighbor port information and neighborship information with local ANCP ports.
show ancp session	Displays details of ANCP sessions and statistics of sessions in each state.
show ancp session event	Displays a snapshot of the last ANCP session event on each port of all neighbors.
show ancp statistics	Collects summaries and statistics from show commands and displays the statistics at one location.
show ancp status	Displays ANCP status information for ANCP endpoints configured on a BRAS interface.

show ancp session

To display details of Access Node Control Protocol (ANCP) sessions and statistics of sessions in each state, use the showancpsession command in user EXEC mode or privileged EXEC mode.

show ancp session [ statistics | adjacency [ name mac-address ] ]

Syntax Description

statistics	(Optional) Displays a summary of ANCP session statistics.
adjacency	(Optional) Displays ANCP adjacency information.
name mac-address	(Optional) Identifies an ANCP session. Only information related to the specified MAC address session appears. The MAC address is entered as a 12-digit hexadecimal string.

Command Default

ANCP session details are displayed.

Command Modes

User EXEC (>) Privileged EXEC(#)

Command History

Release	Modification
12.2(28)ZV2	This command was introduced and implemented on the Cisco 10000 series router.
Cisco IOS XE Release 2.4	This command was integrated into Cisco IOS XE Release 2.4.

Examples

The following example shows sample output that appears when you enter the showancpsession command:

Router# show ancp session
ANCP Session Statistics
=======================
1     ANCP session in SYNSENT state
1     ANCP session in SYNRCVD state
1     ANCP session in ESTAB state
1     ANCP session in DOWN state
4     Total ANCP sessions

The following example shows sample output that appears when you enter the showancpsessionadjacencynamemac-addresscommand:

Router# show ancp session adjacency name 00aa00bb00cc
Remote Address	State	Hello Interval	Interface
		(Seconds)
---------------	-------	 -----------	----------
12.12.1.1	ESTAB	 98	Gi1/0.1
Last Adjacency message received: Message len 40 Capability len 4
Ver/Sub					x31
Message Type        10 (10 Adjacency Protocol)
Timer 					100
M-Flag/Code 					x03 (x80 M 1 SYN 2 SYNACK 3 ACK 4 RSTACK)
Sender Name 					0006.52a5.1c1c
Receiver Name       0006.52a5.141c
Sender Port 					0
Receiver Port 					0
PType/PFlag 					x01 (x10/x20 Fixed Partition request/Assigned 
					1/2 New/Recovered Adjacency)
Sender Instance 					x000001
Partition ID 					0
Receiver Instance   x000001
Tech Type 					5 (5 DSL)
# of TLVs 					1
Total Length 					4
Capability 					(1 Dynamic-Topology-Discovery 2 Line-Configuration 
					3 Transactional-Multicast 4 OAM)
TLV		Type 1 Len 0

The table below lists the significant fields shown in the display.

Table 16

show ancp session Field Descriptions

Field	Description
Ver/Sub	The versionand sub-version number of the GSMP protocol being used in the session. ANCP uses version 3 and sub-version 1 of the GSMP protocol.
Message Type	ANCP message type.
Timer	Specifies the nominal time between periodic adjacency protocol messages. The timer field is specified in units of 100 milliseconds.
M-Flag/Code	Indicates whether the sender is a master or a slave.
PType/PFlag	PType specifies if partitions are used and how the partition ID is negotiated. PFlag indicates the type of partition request.
Sender Instance	Instance number that changes when the access node changes from a down state to an up state.
Partition ID	Partition ID number.
Receiver Instance	Current instance number determined by sender.
Tech Type	The Tech Type indicates the technology to which the capability extension applies. For access node control in case of DSL networks, the value for DSL is 5.
Capability	Adjacency messages include supported capabilities. Capability types include the following: Dynamic-Topology-Discovery Line-Configuration Transactional-Multicast Operations, administration, and maintenance (OAM)
TLV	Type-length-value.

Related Commands

Command	Description
show ancp neighbor	Displays statistics of ANCP neighbor port information and neighborship information with local ANCP ports.
show ancp port	Displays statistics of all ANCP local ports and their respective status and neighbor information.
show ancp session event	Displays a snapshot of the last ANCP session event on each port of all neighbors.
show ancp statistics	Collects summaries and statistics from show commands and displays the statistics at one location.
show ancp status	Displays ANCP status information for ANCP endpoints configured on a BRAS interface.

show ancp session event

To display a snapshot of the last Access Node Control Protocol (ANCP) session event on each port of all neighbors, use the showancpsessionevent command in user EXEC mode or privileged EXEC mode.

show ancp session event [ client-id access-loop-circuit-id ]

Syntax Description

client-id access-loop-circuit-id

(Optional) Only information related to the port appears.

Command Default

The last ANCP session event messages received are displayed.

Command Modes

User EXEC (>) Privileged EXEC (#)

Command History

Release	Modification
12.2(28)ZV2	This command was introduced and implemented on the Cisco 10000 series router.
Cisco IOS XE Release 2.4	This command was integrated into Cisco IOS XE Release 2.4.

Usage Guidelines

The access-loop-circuit-id is a unique ID that the digital subscriber line access multiplexer (DSLAM) sends to the broadband remote access server (BRAS) for each unique port.

Examples

The following example shows sample output that appears when you enter the showancpeventportclient-idaccess-loop-circuit-id command:

Router# show ancp event port client-id abc
Local/Remote              Interface  State   Local/Remote
Socket                                       MAC Address
------------------------- ---------- ------- -------------------------
12.12.2.2(6068)           Gi1/0.1    ESTAB   0006.52a5.141c/
12.12.1.1(11032)/                            0006.52a5.1c1c
 Last ANCP Port event received: Message len 144
  Ver/Sub               x31
  Message Type          80 (80 Port Up 81 Port Down 82 Invalid Label 83 New Port 
                            84 Dead Port 85 Adjacency Update)
  Result/Code           0 (1 NoSuccessAck 2 AckAll 3 Success 4 Failure 5 More 
                            6 ReturnReceipt
  Partition ID          x00
  Transaction ID        x000000
  I/SubMessage Number   x00 (x80 I)
  Length                144
  Port                  x0
  Port Session Number   x0
  Event Sequence Number x0
  Label 1               x0
  Label 2               x0
  Reserved              x00
  Message Type          80 (See Message Type above)
  Tech Type             5 (5 DSL)
  Block Length          0
  # of TLVs             2
  Extension Block Length x00
  Extensions            (1 Access-Loop-Circuit-ID
                         2/3 Access-Aggregation-Circuit-ID-Binary/ASCII 
                         4 DSL Line Attributes)
	TLV                 Type 1 Len 2
    TLV                 Type 4 Len 32

The table below lists the significant fields shown in the display.

Table 17

show ancp session event Field Descriptions

Field	Description
Ver/Sub	The version and sub-version number of the General Switch Management Protocol (GSMP) protocol being used in the session. ANCP uses version 3 and sub-version 1 of the GSMP protocol.
Message Type	ANCP message type.
Result/Code	The Result field has the following codes: Ignore--Ignore this field on receipt and follow the procedures specified for the received message type. Nack--Result code indicating that no response is expected to the message other than in cases of failure caused during the processing of the message contents or that of the contained directives. AckAll--Result code indicating that a response to the message is requested in all cases. It is specifically intended to be used in some cases for Request messages only, and is not to be used in Event messages. Success--Set by receiver to indicate successful execution of all directives in the corresponding Request message. Failure--Set by receiver in the Response message if one or more directives in the corresponding Request message fails.
Transaction ID	The transaction ID is a 24-bit number set by the sender of a request message to associate a response message with the original request message. The receiver of a request message reflects the transaction ID from the request message in the corresponding response message.
I/SubMessage Number	When a message is segmented because it exceeds the maximum transmission unit (MTU) of the link layer, each segment includes a submessage number to indicate its position. If it is the first submessage in a sequence of submessages, the I flag is set and the submessage number contains the total count of submessage segments.
Port Session Number	Port session number maintained by the switch.
Event Sequence Number	The success response message gives the current value of the event sequence number of the switch port indicated by the port field.
Extension Block Length	The extension block length contains one or more type-length-values (TLVs) to identify a digital subscriber line (DSL) and define its characteristics.
Extensions	The network access server (NAS) uses the extension block in the Port Management messages to convey service attributes of the DSL lines to the DSLAM.

Related Commands

Command	Description
show ancp neighbor	Displays statistics of ANCP neighbor port information and neighborship information with local ANCP ports.
show ancp port	Displays statistics of all ANCP local ports and their respective status and neighbor information.
show ancp session	Displays details of ANCP sessions and statistics of sessions in each state.
show ancp statistics	Collects summaries and statistics from show commands and displays the statistics at one location.
show ancp status	Displays ANCP status information for ANCP endpoints configured on a BRAS interface.

show ancp statistics

To collect summaries and statistics from show commands and display the statistics at one location, use the showancpstatistics command in user EXEC mode or privileged EXEC mode.

show ancp statistics

Syntax Description

This command has no arguments or keywords.

Command Modes

User EXEC (>) Privileged EXEC (#)

Command History

Release	Modification
12.2(28)ZV2	This command was introduced and implemented on the Cisco 10000 series router.
Cisco IOS XE Release 2.4	This command was integrated into Cisco IOS XE Release 2.4.

Examples

The following example shows sample output that appears when you enter the showancpstatistics command:

Router# show ancp statistics
Local Port Statistics
=====================
1     ANCP ports in UP state
4     ANCP ports in DOWN state
5     Total ANCP ports
Remote Peer Line Statistics
===========================
4     DSL lines in UNKNOWN state
1     DSL lines in SHOWTIME state
0     DSL lines in IDLE state
0     DSL lines in SILENT state
5     Total DSL Lines
ANCP Session Statistics
=======================
0     ANCP sessions in DOWN state
1     ANCP sessions in ESTAB state
0     ANCP sessions in SYNRCVD state
0     ANCP sessions in SYNSENT state
1     Total ANCP sessions

The table below lists the significant fields shown in the display.

Table 18

show ancp statistics Field Descriptions

Field

Description

ANCP ports

ANCP ports.

DSL lines

The DSL line state appears with one of the following values:

UNKNOWN--Unknown state.

SHOWTIME--Active state.

IDLE--Idle state.

SILENT--Silent state.

ANCP sessions

The ANCP session state appears with one of the following values:

DOWN--Down state.

ESTAB--Established state.

SYNRCVD--Received state.

SYNSENT--Sent state.

Related Commands

Command	Description
show ancp neighbor	Displays information about ANCP and port mappings between the DSLAM and the BRAS, and shows dynamic line conditions.
show ancp port	Displays statistics of all ANCP local ports and their respective status and neighbor information.
show ancp session	Displays details of ANCP sessions and statistics of sessions in each state.
show ancp session event	Displays a snapshot of the last ANCP session event on each port of all neighbors.
show ancp status	Displays ANCP status information for ANCP endpoints configured on a BRAS interface.

show ancp status

To display Access Node Control Protocol (ANCP) status information for ANCP endpoints configured on a broadband remote access server (BRAS) interface, use the showancpstatus command in user EXEC mode or privileged EXEC mode.

show ancp status type number

Syntax Description

type number

Type and number of an interface.

Command Modes

User EXEC (>) Privileged EXEC (#)

Command History

Release	Modification
12.2(28)ZV	This command was introduced and implemented on the Cisco 10000 series router.
12.2(31)ZV1	This command was modified for ANCP, replacing L2CP.
Cisco IOS XE Release 2.4	This command was integrated into Cisco IOS XE Release 2.4.

Examples

The following example shows the status information that appears when you enter the show ancp status command for a specific interface:

Router# show ancp status GigabitEthernet1/0/0
ANCP enabled on the following interfaces
GigabitEthernet1/0/0
ANCP endpoint(s) on this interface:
	ANCP state	ESTAB
	Neighbor 	10.0.0.1 	
	Neighbor port	11005
	Hello interval	100 
	Sender instance	1 
	Sender name	6363218A
	Send port	0 
	Partition ID	0 
	TCB	21289B00

The table below lists the significant fields shown in the display.

Table 19

show ancp status Field Descriptions

Field	Description
Hello interval	Time in seconds between hello packets.
Sender instance	Instance number that changes when the access node changes from a down state to an up state.
Partition ID	Partition ID number.

Related Commands

Command	Description
show ancp neighbor	Displays information about ANCP and port mappings between the DSLAM and the BRAS, and shows dynamic line conditions.
show ancp port	Displays statistics of all ANCP local ports and their respective status and neighbor information.
show ancp session	Displays details of ANCP sessions and statistics of sessions in each state.
show ancp session event	Displays a snapshot of the last ANCP session event on each port of all neighbors.
show ancp statistics	Collects summaries and statistics from show commands and displays the statistics at one location.

show atm pvc

To display all ATM permanent virtual connections (PVCs) and traffic information, use the showatmpvccommand in privileged EXEC mode.

show atm pvc [ interface atm interface-number [ . subinterface ] vpi / vci vaccess [ detail] ]

Syntax Description

vpi / vci	(Optional) ATM virtual path identifier (VPI) and virtual channel identifier (VCI) numbers. The absence of the slash character (/) and a vpi value causes the vpi value to default to 0.
interface atm interface-number	(Optional) Displays all PVCs on the specified ATM interface. To determine the appropriate form of the interface-number argument, consult your ATM network module, port adapter, or router documentation.
. subinterface-number	(Optional) Subinterface number in the range from 1 to 4294967293. The dot (.) is required as a separator between interface-numberand subinterface-number.
vpi / vci	(Optional) Displays the names of all of the virtual access interfaces associated with the PVC vpi/vci on the ATM subinterface you specify.
vaccess detail	Displays information about the virtual access interfaces associated with the PVC vpi/vci on the ATM subinterface you specify.

Command Default

All ATM PVCs are displayed.

Command Modes

Privileged EXEC (#)

Command History

Release	Modification
11.3T	This command was introduced.
12.1(1)T	This command was modified to display PPP over Ethernet (PPPoE) status.
12.2(4)T	This command was modified to display only PVCs that are attached to a virtual access interface. Before this modification, all PVCs that were configured with PPP over ATM (PPPoA) or PPPoE were displayed.
12.0(23)S	This command was modified to display OAM cell emulation status for Any Transport over MPLS (AToM).
12.2(14)S	This command was integrated into Cisco IOS Release 12.2(14)S.
12.3(7)T	This command was modified to display information about multilink PPP over ATM link fragmentation and interleaving for ATM PVCs.
12.0(30)S	This command was modified to display information about OAM loopback detection.
12.2(28)SB	This command was integrated into Cisco IOS Release 12.2(28)SB.
12.2SX	This command is supported in the Cisco IOS Release 12.2SX train. Support in a specific 12.2SX release of this train depends on your feature set, platform, and platform hardware.
12.2(31)SB10	This command was modified to display information about OAM loopback detection.
Cisco IOS XE Release 2.3	This command was implemented on Cisco ASR 1000 series routers.
15.0(1)M	This command was integrated into Cisco IOS Release 15.0(1)M.
12.2(33)SRE	This command was integrated into Cisco IOS Release 12.2(33)SRE.

Usage Guidelines

If you do not specify the vpi/vci or name argument, the output of this command is the same as that of the showatmvccomm and, but only the configured PVCs appear.

If you specify the vpi/vci or name argument, the output of this command is the same as that of the showatmvcvcd command, with extra information related to PVC management, including connection name, detailed states, and Operation, Administration, and Maintenance (OAM) counters. Do not attempt to configure virtual circuit numbers 3 and 4 as these virtual circuits are reserved for OAM.

If you include the interfaceatminterface-numberargument in the command, the output of this command displays all of the PVCs under that interface or subinterface. If you include the vpi/vcivaccess argument, the command output displays the names of all of the virtual access interfaces associated with the PVC on the ATM interface. If you include the vpi/vcivaccessdetail argument, the command output displays detailed virtual access interface information.

The functionality and output of the show atm pvc {interfaceatminterface-numbervpi/vci} command are unchanged.

Examples

The following is sample output from theshowatmpvc command. The output is the same as that of the showatmvccomm and, but only the configured PVCs appear.

Router# show atm pvc
           VCD/                                 Peak      Avg/Min   Burst
Interface  Name   VPI   VCI   Type   Encaps      Kbps         Kbps   Cells      Sts
2/0        1        0     5    PVC     SAAL    155000       155000               UP
2/0        2        0    16    PVC     ILMI    155000       155000               UP
2/0.2      101      0    50    PVC     SNAP    155000       155000               UP
2/0.2      102      0    60    PVC     SNAP    155000       155000             DOWN
2/0.2      104      0    80    PVC     SNAP    155000       155000               UP
2/0        hello    0    99    PVC     SNAP      1000                            UP

The following is sample output from the showatmpvc command with the vpi/vci argument specified:

Router# show atm pvc 0/41
ATM2/0: VCD: 3, VPI: 0, VCI: 41
UBR, PeakRate: 155000
AAL5-LLC/SNAP, etype:0x0, Flags: 0xC20, VCmode: 0x0
OAM frequency: 0 second(s), OAM retry frequency: 1 second(s), OAM retry frequency: 1 second(s)
OAM up retry count: 3, OAM down retry count: 5
OAM Loopback status: OAM Disabled
OAM VC state: Not Managed
OAM Loop detection: Disabled
ILMI VC state: Not Managed
InARP frequency: 15 minutes(s)
InPkts: 31759, OutPkts: 26497, InBytes: 2356434, OutBytes: 1589743
InPRoc: 15785, OutPRoc: 26472, Broadcasts: 0
InFast: 20, OutFast: 20, InAS: 15954, OutAS: 6
OAM cells received: 0
F5 InEndloop: 0, F5 InSegloop: 0, F5 InAIS: 0, F5 InRDI: 0
F4 InEndloop: 0, F4 InSegloop: 0, F4 InAIS: 0, F4 InRDI: 0
OAM cells sent: 0
F5 OutEndloop: 0, F5 OutSegloop: 0, F5 OutRDI: 0
F4 OutEndloop: 0, F4 OutSegloop: 0, F4 OutRDI: 0
OAM cell drops: 0
Status: UP
PPPOE enabled.

The following sample output from the showatmpvc command displays OAM cell emulation statistics, which are marked in this example by exclamation points:

Router# show atm pvc 5/500
ATM4/1/0.200: VCD: 6, VPI: 5, VCI: 500                    
UBR, PeakRate: 1                                         
AAL5-LLC/SNAP, etype:0x0, Flags: 0x34000C20, VCmode: 0x0 
OAM Cell Emulation: enabled, F5 End2end AIS Xmit frequency: 1 second(s) !!!
OAM frequency: 0 second(s), OAM retry frequency: 1 second(s)
OAM up retry count: 3, OAM down retry count: 5
OAM Loopback status: OAM Disabled
OAM VC state: Not ManagedVerified
OAM Loop detection: Disabled
ILMI VC state: Not Managed
InPkts: 564, OutPkts: 560, InBytes: 19792, OutBytes: 19680
InPRoc: 0, OutPRoc: 0
InFast: 4, OutFast: 0, InAS: 560, OutAS: 560
InPktDrops: 0, OutPktDrops: 0
CrcErrors: 0, SarTimeOuts: 0, OverSizedSDUs: 0
Out CLP=1 Pkts: 0
OAM cells received: 26
F5 InEndloop: 0, F5 InSegloop: 0, F5 InAIS: 0, F5 InRDI: 26
OAM cells sent: 77
F5 OutEndloop: 0, F5 OutSegloop: 0, F5 OutAIS: 77, F5 OutRDI: 0  !!!
OAM cell drops: 0
Status: UP

The following is sample output from the showatmpvc command with the ATM subinterface specified:

Router# show atm pvc interface atm 2/0.2
           VCD/                                 Peak      Avg/Min   Burst
Interface  Name   VPI   VCI   Type   Encaps     Kbps         Kbps   Cells       Sts
2/0.2      101     0    50    PVC      SNAP   155000       155000                UP
2/0.2      102     0    60    PVC      SNAP   155000       155000              DOWN
2/0.2      104     0    80    PVC      SNAP   155000       155000                UP

The following is sample output for the showatmpvc command for a PVC that is a member of a multilink PPP bundle:

Router# show atm pvc 15/200
ATM4/0.10000:VCD:16, VPI:15, VCI:200
UBR, PeakRate:149760 (353208 cps)
AAL5-LLC/SNAP, etype:0x0, Flags:0xC20, VCmode:0x0, Encapsize:12
OAM frequency:0 second(s), OAM retry frequency:1 second(s)
OAM up retry count:3, OAM down retry count:5
OAM Loopback status:OAM Disabled
OAM VC State:Not Managed
OAM Loop detection: Disabled
ILMI VC status:Not Managed
VC TxRingLimit:40 particles
VC Rx Limit:800 particles
InARP frequency:15 minutes(s)
Transmit priority 6
InPkts:347, OutPkts:399, InBytes:6268, OutBytes:7728
InCells:347, OutCells:399
InPRoc:7, OutPRoc:228
InFast:338, OutFast:169, InAS:0, OutAS:0
InPktDrops:0, OutPktDrops:0/0/0 (holdq/outputq/total)
InCellDrops:0, OutCellDrops:0
InByteDrops:0, OutByteDrops:0
CrcErrors:0, SarTimeOuts:0, OverSizedSDUs:0, LengthViolation:0, CPIErrors:0
Out CLP=1 Pkts:0, Cells:0
OAM cells received:0
F5 InEndloop:0, F5 InSegloop:0, F5 InAIS:0, F5 InRDI:0
F4 InEndloop:0, F4 InSegloop:0, F4 InAIS:0, F4 InRDI:0
OAM cells sent:0
F5 OutEndloop:0, F5 OutSegloop:0, F5 OutRDI:0
F4 OutEndloop:0, F4 OutSegloop:0, F4 OutRDI:0
OAM cell drops:0
Status:UP
PPP:Virtual-Access3 from Virtual-Template1
PPPoA Current State = LOCALLY_TERMINATED
PPPoA Latest  Event = Vaccess Up
PPPoA Latest  Error = None
PPPoA Session ID    = 7
PPPoA  Handle = 0x4D000006, SSS Handle = 0x00000000
Switch Handle = 0xB5000006, PPP Handle = 0xD700000A
AAA Unique ID = 0x00000007, AIE Handle = 0xE7000006
PVC belongs to Multilink PPP Bundle Virtual-Access4 as a PPPoA member link
Packets in VC Holdq:0 , Particles in VC Tx Ring:0

The following is sample output from the showatmpvccommand with loopback detection mode through OAM enabled:

Router# show atm pvc 4/100
ATM1/0: VCD: 4, VPI: 4, VCI: 100
UBR, PeakRate: 149760
AAL5-LLC/SNAP, etype:0x0, Flags: 0xC20, VCmode: 0x0
!
OAM frequency: 10 second(s), OAM retry frequency: 1 second(s)
OAM up retry count: 3, OAM down retry count: 5
OAM Loopback status: OAM Received
OAM VC state: Verified
OAM Loop detection: Enabled ! Indicates that loopback mode detection is enabled.
!
ILMI VC state: Not Managed
VC is managed by OAM.
InARP frequency: 15 minutes(s)
Transmit priority 4
InPkts: 0, OutPkts: 0, InBytes: 0, OutBytes: 0
InPRoc: 0, OutPRoc: 0, Broadcasts: 0
InFast: 0, OutFast: 0, InAS: 0, OutAS: 0
InPktDrops: 0, OutPktDrops: 0
CrcErrors: 0, SarTimeOuts: 0, OverSizedSDUs: 0
Out CLP=1 Pkts: 0
OAM cells received: 27
F5 InEndloop: 27, F5 InSegloop: 0, F5 InAIS: 0, F5 InRDI: 0
OAM cells sent: 27
F5 OutEndloop: 27, F5 OutSegloop: 0, F5 OutAIS: 0, F5 OutRDI: 0
OAM cell drops: 3
Status: UP

The following is sample output from the showatmpvc command when loopback mode is detected:

Router# show atm pvc 4/100
ATM1/0: VCD: 4, VPI: 4, VCI: 100
UBR, PeakRate: 149760
AAL5-LLC/SNAP, etype:0x0, Flags: 0xC20, VCmode: 0x0
!
OAM frequency: 10 second(s), OAM retry frequency: 1 second(s)
OAM up retry count: 3, OAM down retry count: 5
OAM Loopback status: OAM Sent
OAM VC state: Not Verified
OAM Loop detection: Enabled, Detected ! Indicates that loopback mode has been detected on this interface.
!
ILMI VC state: Not Managed
VC is managed by OAM.
InARP frequency: 15 minutes(s)
Transmit priority 4
InPkts: 0, OutPkts: 0, InBytes: 0, OutBytes: 0
InPRoc: 0, OutPRoc: 0, Broadcasts: 0
InFast: 0, OutFast: 0, InAS: 0, OutAS: 0
InPktDrops: 0, OutPktDrops: 0
CrcErrors: 0, SarTimeOuts: 0, OverSizedSDUs: 0
Out CLP=1 Pkts: 0
OAM cells received: 20
F5 InEndloop: 20, F5 InSegloop: 0, F5 InAIS: 0, F5 InRDI: 0
OAM cells sent: 20
F5 OutEndloop: 20, F5 OutSegloop: 0, F5 OutAIS: 0, F5 OutRDI: 0
OAM cell drops: 1
Status: DOWN, State: NOT_VERIFIED

Cisco 10000 Series Router

The following example shows sample output from the showatmpvcinterfaceatminterface-numbervpi/vcivaccess command. In the output, the vpi/vcivaccess option causes the name of all of the virtual access interfaces (VAIs) to appear. These VAIs are associated with PVC 100/1000 on ATM subinterface ATM 3/0/0.6.

Router# show atm pvc interface atm3/0/0.6 100/1000 vaccess 
			VCD / 	Protocol	Virtual Access
Interface		Name	VPI VCI	Type	Interface
ATM3/0/0.6	3	100 1000	pppoe	Vi3.1

The following example shows sample output when using the showatmpvcinterfaceatminterface-numbervpi/vcivaccessdetail command. The output is similar to the output that appears when you use the showinterfacevirtual-access-number command.

Router# show atm pvc interface atm3/0/0.6 100/1000 vaccess detail
 
ATM3/0/0.6: VCD: 3 VPI: 100 VCI: 1000
Virtual-Access3.1 is up, line protocol is up 
Hardware is Virtual Access interface
Internet address will be negotiated using IPCP
MTU 1492 bytes, BW 599040 Kbit, DLY 100000 usec, 
reliability 255/255, txload 1/255, rxload 1/255
Encapsulation PPP, LCP Open
Stopped: IPCP
PPPoE vaccess, cloned from Virtual-Template1
Vaccess status 0x0
PPPoE Bound to ATM3/0/0.6 VCD: 3, VPI: 100, VCI: 1000
Keepalive set (10 sec)
3 packets input, 50 bytes
3 packets output, 44 bytes
Last clearing of "show interface" counters never

The table below describes the significant fields shown in the displays.

Table 20

show atm pvc Field Descriptions

Field	Description
Interface	Interface and subinterface slot and port.
VCD/Name	Virtual connection descriptor (virtual connection number). The connection name is displayed if a name for the VC was configured using the pvc command.
VPI	Virtual path identifier.
VCI	Virtual channel identifier.
Type	Type of PVC detected from PVC discovery; either PVC-D, PVC-L, or PVC-M: PVC-D--PVC created as a result of PVC discovery. PVC-L--The corresponding peer of this PVC could not be found on the switch. PVC-M--Some or all of the QoS¹ parameters of this PVC fail to match those of the corresponding peer on the switch.
Encaps	Type of ATM adaptation layer (AAL) and encapsulation.
Peak or PeakRate	Kilobits per second sent at the peak rate.
Avg/Min or Average Rate	Kilobits per second sent at the average rate.
Burst Cells	Maximum number of ATM cells that the VC can send at peak rate.
Sts or Status	Status of the VC connection: UP--The connection is enabled for data traffic. DOWN--The connection is not ready for data traffic. When the Status field is DOWN, a State field is shown. See a description of the different values for the State field later in this table. INACTIVE--The interface is down.
Connection Name	Name of the PVC.
UBR, UBR+, or VBR-NRT	UBR--Unspecified bit rate QoS is specified for this PVC. See the ubr command for further information. UBR+--Unspecified bit rate QoS is specified for this PVC. See the ubr+ command for further information. VBR-NRT--Variable bit rate-non-real-time QoS rates are specified for this PVC. See the vbr-nrt command for further information.
etype	Encapsulation type.
Flags	Bit mask describing VC information. The flag values are summed to result in the displayed value: 0x40--SVC 0x20--PVC 0x10--ACTIVE 0x0--AAL5-SNAP 0x1--AAL5-NLPID 0x2--AAL5-FRNLPID 0x3--AAL5-MUX 0x4--AAL3/4-SMDS 0x5--QSAAL 0x6--ILMI 0x7--AAL5-LANE 0x9--AAL5-CISCOPPP
virtual-access	Virtual-access interface identifier.
virtual-template	Virtual template identifier.
VCmode	AIP-specific or NPM-specific register describing the usage of the VC. This register contains values such as rate queue, peak rate, and AAL mode, which are also displayed in other fields.
OAM Cell emulation	The status of the OAM cell emulation functionality. It is either enabled or disabled.
F5 end2end AIS xmit frequency	Number of seconds between transmissions of AIS cells.
OAM frequency	Number of seconds between transmissions of OAM loopback cells.
OAM retry frequency	Frequency (in seconds) at which end-to-end F5 loopback cells should be sent when a change in state (up or down) is being verified. For example, if a PVC is up and a loopback cell response is not received after the value of the frequency argument (in seconds) specified using the oam-pvc command, loopback cells are sent at the value of the retry-frequency argument to determine whether the PVC is down.
OAM up retry count	Number of consecutive end-to-end F5 OAM loopback cell responses that must be received in order to change a PVC state to up. Does not apply to SVCs.
OAM down retry count	Number of consecutive end-to-end F5 OAM loopback cell responses that if not received, change a PVC state to down or tear down an SVC.
OAM Loopback status	Status of end-to-end F5 OAM loopback cell generation for this VC. This field will have one of the following values: OAM Disabled--End-to-end F5 OAM loopback cell generation is disabled. OAM Sent--OAM cell was sent. OAM Received--OAM cell was received. OAM Failed--OAM reply was not received within the frequency period or contained a bad correlation tag.
OAM VC state	This field will have one of the following states for this VC: AIS²/RDI³--The VC received AIS/RDI cells. End-to-end F5 OAM loopback cells are not sent in this state. Down Retry--An OAM loopback failed. End-to-end F5 OAM loopback cells are sent at retry frequency to verify that the VC is really down. After down-count unsuccessful retries, the VC goes to the Not Verified state. Not Managed--VC is not being managed by OAM. Not Verified--VC has not been verified by end-to-end F5 OAM loopback cells. AIS and RDI conditions are cleared. Up Retry--An OAM loopback was successful. End-to-end F5 OAM loopback cells are sent at retry frequency to verify that the VC is really up. After up-count successive and successful loopback retries, the VC goes to the Verified state. Verified--Loopbacks are successful. AIS/RDI cell was not received.
OAM Loop detection	Status of loopback detection mode through OAM: Disabled--Automatic loopback detection is disabled. Enabled--Automatic loopback detection is enabled. Detected--Loopback mode is detected on an ATM interface.
ILMI VC state	This field will have one of the following states for this VC: Not Managed--VC is not being managed by ILMI⁴. Not Verified--VC has not been verified by ILMI. Verified--VC has been verified by ILMI.
VC is managed by OAM/ILMI	VC is managed by OAM or ILMI.
InARP frequency	Number of minutes for the Inverse Address Resolution Protocol time period.
InPkts	Total number of packets received on this VC. This number includes all fast-switched and process-switched packets.
OutPkts	Total number of packets sent on this VC. This number includes all fast-switched and process-switched packets.
InBytes	Total number of bytes received on this VC. This number includes all fast-switched and process-switched bytes.
OutBytes	Total number of bytes sent on this VC. This number includes all fast-switched and process-switched bytes.
InPRoc	Number of process-switched input packets.
OutPRoc	Number of process-switched output packets.
Broadcasts	Number of process-switched broadcast packets.
InFast	Number of fast-switched input packets.
OutFast	Number of fast-switched output packets.
InAS	Number of autonomous-switched or silicon-switched input packets.
OutAS	Number of autonomous-switched or silicon-switched output packets.
OAM cells received	Total number of OAM cells received on this VC.
F5 InEndloop	Number of end-to-end F5 OAM loopback cells received.
F5 InSegloop	Number of segment F5 OAM loopback cells received.
F5 InAIS	Number of F5 OAM AIS cells received.
F5 InRDI	Number of F5 OAM RDI cells received.
F4 InEndloop	Number of end-to-end F4 OAM loopback cells received.
F4 InSegloop	Number of segment F4 OAM loopback cells received.
F4 InAIS	Number of F4 OAM AIS cells received.
F4 InRDI	Number of F4 OAM RDI cells received.
OAM cells sent	Total number of OAM cells sent on this VC.
F5 OutEndloop	Number of end-to-end F5 OAM loopback cells sent.
F5 OutSegloop	Number of segment F5 OAM loopback cells sent.
F5 OutRDI	Number of F5 OAM RDI cells sent.
OAM cell drops	Number of OAM cells dropped (or flushed).
PVC Discovery	NOT_VERIFIED--This PVC is manually configured on the router and not yet verified with the attached adjacent switch. WELL_KNOWN--This PVC has a VCI value of 0 through 31. DISCOVERED--This PVC is learned from the attached adjacent switch via ILMI. MIXED--Some of the traffic parameters for this PVC were learned from the switch via ILMI. MATCHED--This PVC is manually configured on the router, and the local traffic-shaping parameters match the parameters learned from the switch. MISMATCHED--This PVC is manually configured on the router, and the local traffic-shaping parameters do not match the parameters learned from the switch. LOCAL_ONLY--This PVC is configured locally on the router and not on the remote switch.
Status	When the Status field indicates UP, the VC is established. When the Status field indicates DOWN, refer to the State field for further information about the VC state.
State	When the Status field is UP, this field does not appear. When the Status field is DOWN or INACTIVE, the State field will appear with one of the following values: NOT_VERIFIED--The VC has been established successfully; waiting for OAM (if enabled) and ILMI (if enabled) to verify that the VC is up. NOT_EXIST--VC has not been created. HASHING_IN--VC has been hashed into a hash table. ESTABLISHING--Ready to establish VC connection. MODIFYING--VC parameters have been modified. DELETING--VC is being deleted. DELETED--VC has been deleted. NOT_IN_SERVICE--ATM interface is shut down.
PPP	For PPP over ATM, indicates the virtual access interface number and virtual template number being used.
PPPoA Current State	State of the PPPoA session associated with the VC.
PPPoA Latest Event	The latest event that occurred on the PPPoA session associated with the VC.
PPPoA Latest Error	The latest error that occurred on the PPPoA session associated with the VC.
PPPoA Session ID	PPPoA session identifier of the PPPoA session associated with the VC.
PPPoA Handle	PPPoA context handle.
SSS Handle	SSS handle for PPPoA session associated with the VC.
Switch Handle	SSS handle for switch management.
PPP Handle	Handle associated with the PPP context.
AAA Unique ID	Unique identifier associated with the AAA session.
AIE Handle	Access IE handle for the PPPoA session.
Packets in VC Holdq	Number of packets in the hold queue of the VC.
Particles in VC Tx Ring	Number of particles in the Tx ring of the VC.

¹ QoS = quality of service

² AIS = alarm indication signal

³ RDI = remote defect identification

⁴ ILMI = Interim Local Management Interface

Related Commands

Command	Description
show atm svc	Displays all ATM SVCs and traffic information.
show atm vc	Displays all ATM PVCs and SVCs and traffic information.

subscriber service

To enable per-subscriber services, use the subscriber service command in global configuration mode. To disable per-subscriber services, use the no form of this command.

subscriber service { accounting interim-interval minutes | coa-rfc-compliant | ignore | multiple-accept | password | police | session-accounting | shaper | target-atm-vc | vc-ignore-cos }

no subscriber service { accounting interim-interval minutes | coa-rfc-compliant | ignore | multiple-accept | password | police | session-accounting | shaper | target-atm-vc | vc-ignore-cos }

Syntax Description

accounting interim-interval minutes	Enables the generation of interim service accounting records at periodic intervals for subscribers. The minutes argument indicates the number of periodic intervals to send accounting update records from 1 to 71582 minutes.
coa-rfc-compliant	Sends RFC 3576 compliant change of authorization (CoA) NAK messages.
ignore	Ignores any of per-subscriber services.
multiple-accept	Allows multiple services on access-accept.
password	Password to use when downloading services.
police	Quality of service (QoS) RADIUS service police command.
session-accounting	Enables the inclusion of activated services in a session accounting start message.
shaper	QoS RADIUS service shaper command.
target-atm-vc	Enables the QoS service on the target ATM virtual circuit (VC).
vc-ignore-cos	Ignores the set Layer 2 class of service (set-cos) value on the target ATM VC.

Command Default

Service accounting is disabled.

Command Modes

Global configuration (config)

Command History

Release	Modification
Release 12.2(31)ZV1	This command was introduced for session accounting and was implemented on the Cisco 10000 series router for the PRE3.
Cisco IOS XE Release 2.4	This command was integrated into Cisco IOS XE Release 2.4.

Usage Guidelines

The subscriber service session-accounting command enables the router to include all activated services in a single accounting Session-Start message for a session.

RADIUS can activate a service using the RADIUS Access-Accept message. When RADIUS activates a service on the router after the router sends the accounting Session-Start message, the router generates an accounting session update that includes all activated services.

When a session stops, all currently active services are included in the accounting session stop record.

The subscriber service accounting interim-intervalcommand enables the router to generate interim service accounting records at periodic intervals for subscribers. RADIUS Attribute 85 in the user service profile always takes precedence over the configured interim-interval value. RADIUS Attribute 85 must be in the user service profile. See the RADIUS Attributes Overview and RADIUS IETF Attributes feature document for more information.

Note

If RADIUS Attribute 85 is not in the user service profile, then the interim-interval value is used for service interim accounting records. The interim-interval value is configured by either using the aaa accounting update command in global configuration mode or the action-type command in accounting method list configuration mode. See the Configuring Accounting feature document for more information.

Examples

The following example enables per-service accounting:

Router(config)# subscriber service session-accounting

Related Commands

Command	Description
bandwidth account	Enables class-based fair queuing and ATM overhead accounting.
shape account	Shapes traffic to the indicated bit rate and enables ATM overhead accounting.

subscriber service multiple-accept

To configure the BRAS to accept multiple service processing use the subscriber service multiple-acceptcommand in global configuration mode. To turn off multiple service processing use the no form of the command.

subscriber service multiple-accept

no subscriber service multiple-accept

Syntax Description

This command has no arguments or keywords.

Command Default

Multiple service processing is not enabled.

Command Modes

Global configuration

Command History

Release	Modification
12.2(31)ZV	This command was introduced and implemented on the Cisco 10000 series router.
Cisco IOS XE Release 2.4	This command was implemented on the Cisco ASR 1000 Series Aggregation Services Router.

Examples

The following sample configuration shows how to turn on the subscriber service multiple-accept feature.

ip dhcp class MY_DHCP
!
ip cef
!
!
subscriber service multiple-accept
subscriber access pppoe pre-authorize nas-port-id default
subscriber authorization enable
vpdn enable
!
redirect server-group rabapol-l4redirect-group
ip 217.89.29.149 port 80

test aaa group

To associate a dialed number identification service (DNIS) or calling line identification (CLID) user profile with the record that is sent to the RADIUS server or to manually test load-balancing server status, use the test aaa group command in privileged EXEC mode.

DNIS and CLID User Profile

test aaa group { group-name | radius } username password new-code [ profile profile-name ]

RADIUS Server Load Balancing Manual Testing

test aaa group group-name [ server ip-address ] [ auth-port port-number ] [ acct-port port-number ] username password new-code [ count requests ] [ rate requests-per-second ] [ blocked { yes | no } ]

Syntax Description

group-name

Subset of RADIUS servers that are used, as defined by the server group group-name.

radius

Uses RADIUS servers for authentication.

username

Name for the test user.

Caution

If you use this command to manually test RADIUS load-balancing server state, it is recommended that a test user, one that is not defined on the RADIUS server, be used to protect against security issues that may arise if the test user is not correctly configured.

password

Password.

new-code

Code path through the new code, which supports a CLID or DNIS user profile association with a RADIUS server.

profile profile-name

(Optional) Identifies the user profile specified in the aaa user profile command. To associate a user profile with the RADIUS server, you must identify the user profile name.

server ip-address

(Optional) For RADIUS server load balancing, specifies to which server in the server group the test packets will be sent.

auth-port

(Optional) User Datagram Protocol (UDP) destination port for authentication requests.

port-number

(Optional) Port number for authentication requests; the host is not used for authentication if set to 0. If unspecified, the port number defaults to 1646.

acct-port

(Optional) UDP destination port for accounting requests.

port-number

(Optional) Port number for accounting requests; the host is not used for accounting if set to 0. If unspecified, the port number defaults to 1646.

count requests

(Optional) Number of authentication and accounting requests that are to be sent to the server for each port. Range: 1 to 50000. Default: 1.

rate requests-per-second

(Optional) Number of requests per second that are to be sent to the server. Range: 1 to 1000. Default: 10.

blocked {yes | no}

(Optional) Specifies whether the request is sent in blocking or nonblocking mode.

If the blocked keyword is not used and one request is sent, the default is yes; if more than one request is sent, the default is no.

DNIS and CLID User Profile

DNIS or CLID attribute values are not sent to the RADIUS server.

RADIUS Server Load Balancing Manual Testing

RADIUS server load-balancing server status manual testing does not occur.

Command Modes

Privileged EXEC (#)

Command History

Release	Modification
12.2(4)T	This command was introduced.
12.2(28)SB	The following keywords and arguments were added for configuring RADIUS load balancing manual testing functionality: server ip-address, auth-port port-number, acct-port port-number, count request, rate requests-per-second, blocked.
12.4(11)T	This command was integrated into Cisco IOS Release 12.4(11)T.
12.2(31)ZV1	This command was enhanced to show user attributes returned from RADIUS authentication when authentication is successful.
Cisco IOS XE Release 2.4	This command was integrated into Cisco IOS XE Release 2.4.

Usage Guidelines

The test aaa group command can be used to

Associate a DNIS or CLID named user profile with the record that is sent to the RADIUS server, which can then access DNIS or CLID information when the server receives a RADIUS record.
Verify RADIUS load-balancing server status.

Note

The test aaa groupcommand does not work with TACACS+.

Examples

The following example shows how to configure a dnis = dnisvalue user profile named prfl1 and associate it with a test aaa groupcommand:

aaa user profile prfl1
  aaa attribute dnis
  aaa attribute dnis dnisvalue
  no aaa attribute clid
! Attribute not found.
  aaa attribute clid clidvalue
  no aaa attribute clid 
  exit
!
! Associate the dnis user profile with the test aaa group command.
test aaa group radius user1 pass new-code profile prfl1

The following example shows the response from a load-balanced RADIUS server that is alive when the username "test" does not match a user profile. The server is verified alive when it issues an Access-Reject response to a AAA packet generated by the test aaa group command.

Router# test aaa group SG1 test lab new-code
 
00:06:07: RADIUS/ENCODE(00000000):Orig. component type = INVALID
00:06:07: RADIUS/ENCODE(00000000): dropping service type, "radius-server attribute 6 on-for-login-auth" is off
00:06:07: RADIUS(00000000): Config NAS IP: 192.0.2.4
00:06:07: RADIUS(00000000): sending
00:06:07: RADIUS/ENCODE: Best Local IP-Address 192.0.2.141 for Radius-Server 192.0.2.176
00:06:07: RADIUS(00000000): Send Access-Request to 192.0.2.176:1645 id 1645/1, len 50
00:06:07: RADIUS:  authenticator CA DB F4 9B 7B 66 C8 A9 - D1 99 4E 8E A4 46 99 B4
00:06:07: RADIUS:  User-Password       [2]   18  *
00:06:07: RADIUS:  User-Name           [1]   6   "test"
00:06:07: RADIUS:  NAS-IP-Address      [4]   6   192.0.2.141               
00:06:07: RADIUS: Received from id 1645/1 192.0.2.176:1645, Access-Reject, len 44
00:06:07: RADIUS:  authenticator 2F 69 84 3E F0 4E F1 62 - AB B8 75 5B 38 82 49 C3
00:06:07: RADIUS:  Reply-Message       [18]  24  
00:06:07: RADIUS:   41 75 74 68 65 6E 74 69 63 61 74 69 6F 6E 20 66  [Authentication ]
00:06:07: RADIUS:   61 69 6C 75 72 65                                [failure]
00:06:07: RADIUS(00000000): Received from id 1645/1
00:06:07: RADIUS/DECODE: Reply-Message fragments, 22, total 22 bytes

Cisco 10000 Series Router

The following example shows the user attribute list that the RADIUS server returns when you issue the test aaa command and authentication is successful:

Router# test aaa group radius viral viral new-code blocked no 
AAA/SG/TEST: Sending 1 Access-Requests @ 10/sec, 0 Accounting-Requests @ 10/sec
CLI-1#
AAA/SG/TEST: Testing Status
AAA/SG/TEST:      Authen Requests to Send    : 1
AAA/SG/TEST:      Authen Requests Processed  : 1
AAA/SG/TEST:      Authen Requests Sent       : 1
AAA/SG/TEST:      Authen Requests Replied    : 1
AAA/SG/TEST:      Authen Requests Successful : 1
AAA/SG/TEST:      Authen Requests Failed     : 0
AAA/SG/TEST:      Authen Requests Error      : 0
AAA/SG/TEST:      Authen Response Received   : 1
AAA/SG/TEST:      Authen No Response Received: 0
AAA/SG/TEST: Testing Status
AAA/SG/TEST:      Account Requests to Send    : 0
AAA/SG/TEST:      Account Requests Processed  : 0
AAA/SG/TEST:      Account Requests Sent       : 0
AAA/SG/TEST:      Account Requests Replied    : 0
AAA/SG/TEST:      Account Requests Successful : 0
AAA/SG/TEST:      Account Requests Failed     : 0
AAA/SG/TEST:      Account Requests Error      : 0
AAA/SG/TEST:      Account Response Received   : 0
AAA/SG/TEST:      Account No Response Received: 0
USER ATTRIBUTES
username             "Username:viral"
nas-ip-address       3.1.1.1
interface            "210"
service-type         1 [Login]
Framed-Protocol      3 [ARAP]
ssg-account-info     "S20.5.0.2"
ssg-command-code     0B 4C 32 54 50 53 55 52 46 
Router

Related Commands

Command	Description
aaa attribute	Adds DNIS or CLID attribute values to a user profile.
aaa user profile	Creates a AAA user profile.
load-balance	Enables RADIUS server load-balancing for RADIUS-named server groups.
radius-server host	Enables RADIUS automated testing for load balancing.
radius-server load-balance	Enables RADIUS server load-balancing for the global RADIUS server group.

Cisco IOS Access Node Control Protocol Command Reference

Bias-Free Language

Results

Chapter: Cisco IOS Access Node Control Protocol Commands

aaa connect-info

ATM

Syntax Description

Command Default

Command Modes

Command History

Usage Guidelines

Examples

ATM PVC Configuration Mode

ATM PVC Range Configuration Mode

ATM PVC-in-Range Configuration Mode

ATM VC Class Configuration Mode

Related Commands

ancp adjacency timer

Syntax Description

Command Default

Command Modes

Command History

Examples

Related Commands

ancp atm shaper

Syntax Description

Command Default

Command Modes

Command History

Usage Guidelines

Examples

Related Commands

ancp enable

Syntax Description

Command Default

Command Modes

Command History

Usage Guidelines

Examples

Related Commands

ancp enable test-configuration

Syntax Description

Command Default

Command Modes

Command History

Usage Guidelines

Examples

Related Commands

ancp neighbor

Syntax Description

Command Default

Command Modes

Command History

Usage Guidelines

Examples

Related Commands

ancp truncate

Syntax Description

Command Default

Command Modes

Command History

Usage Guidelines

Examples

Related Commands

ancp vdsl ethernet shaper

Syntax Description

Command Default

Command Modes

Command History

Usage Guidelines

Examples

Related Commands

dot1q

Syntax Description

Command Default

Command Modes

Command History

Usage Guidelines

Examples

Related Commands